Cargando…
In Vitro FVIII-Encoding Transgenic Mesenchymal Stem Cells Maintain Successful Coagulation in FVIII-Deficient Plasma Mimicking Hemophilia A
OBJECTIVE: Hemophilia A is an X-linked recessive bleeding disorder caused by a deficiency of plasma coagulation factor VIII (FVIII), and it accounts for about 80%-85% of all cases of hemophilia. Plasma-derived therapies or recombinant FVIII concentrates are used to prevent and treat the bleeding sym...
Autores principales: | , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Galenos Publishing
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10240160/ https://www.ncbi.nlm.nih.gov/pubmed/37022209 http://dx.doi.org/10.4274/tjh.galenos.2023.2022-0318 |
_version_ | 1785053690040680448 |
---|---|
author | Hemşinlioğlu, Cansu Aslan, Elif Sibel Taştan, Cihan Çakırsoy, Didem Turan, Raife Dilek Seyis, Utku Elek, Muhammer Karakuş, Gözde Sır Günaydın, Ömür Selin Abanuz, Selen Kançağı, Derya Dilek Yurtsever, Bulut Yalçın, Koray Kasap, Murat Ovalı, Ercüment |
author_facet | Hemşinlioğlu, Cansu Aslan, Elif Sibel Taştan, Cihan Çakırsoy, Didem Turan, Raife Dilek Seyis, Utku Elek, Muhammer Karakuş, Gözde Sır Günaydın, Ömür Selin Abanuz, Selen Kançağı, Derya Dilek Yurtsever, Bulut Yalçın, Koray Kasap, Murat Ovalı, Ercüment |
author_sort | Hemşinlioğlu, Cansu |
collection | PubMed |
description | OBJECTIVE: Hemophilia A is an X-linked recessive bleeding disorder caused by a deficiency of plasma coagulation factor VIII (FVIII), and it accounts for about 80%-85% of all cases of hemophilia. Plasma-derived therapies or recombinant FVIII concentrates are used to prevent and treat the bleeding symptoms along with FVIII-mimicking antibodies. Recently, the European Medicines Agency granted conditional marketing approval for the first gene therapy for hemophilia A. The aim of this study was to determine the effectiveness of coagulation in correcting FVIII deficiency with FVIII-secreting transgenic mesenchymal stem cells (MSCs). MATERIALS AND METHODS: A lentiviral vector encoding a B domain-deleted FVIII cDNA sequence with CD45R0 truncated (CD45R0t) surface marker was designed to develop a transgenic FVIII-expressing primary cell line by transducing MSCs. The efficacy and functionality of the FVIII secreted from the MSCs was assessed with anti-FVIII ELISA, CD45R0t flow cytometry, FVIII western blot, and mixing test analysis in vitro. RESULTS: The findings of this study showed that the transgenic MSCs maintained persistent FVIII secretion. There was no significant difference in FVIII secretion over time, suggesting stable FVIII expression from the MSCs. The functionality of the FVIII protein secreted in the MSC supernatant was demonstrated by applying a mixing test in coagulation analysis. In the mixing test analysis, FVIII-deficient human plasma products were mixed with either a saline control or FVIII-secreted MSC supernatant. The mean FVIII level of the saline control group was 0.41±0.03 IU/dL, whereas the mean level was 25.41±33.38 IU/dL in the FVIII-secreting MSC supernatant mixed group (p<0.01). The mean activated partial thromboplastin time (aPTT) of the saline control group was 92.69±11.38 s, while in the FVIII-secreting MSC supernatant mixed group, the mean aPTT level decreased to 38.60±13.38 s (p<0.001). CONCLUSION: The findings of this in vitro study suggest that the new method presented here is promising as a possible treatment for hemophilia A. Accordingly, a study of FVIII-secreting transgenic MSCs will next be initiated in a FVIII-knockout animal model. |
format | Online Article Text |
id | pubmed-10240160 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Galenos Publishing |
record_format | MEDLINE/PubMed |
spelling | pubmed-102401602023-06-06 In Vitro FVIII-Encoding Transgenic Mesenchymal Stem Cells Maintain Successful Coagulation in FVIII-Deficient Plasma Mimicking Hemophilia A Hemşinlioğlu, Cansu Aslan, Elif Sibel Taştan, Cihan Çakırsoy, Didem Turan, Raife Dilek Seyis, Utku Elek, Muhammer Karakuş, Gözde Sır Günaydın, Ömür Selin Abanuz, Selen Kançağı, Derya Dilek Yurtsever, Bulut Yalçın, Koray Kasap, Murat Ovalı, Ercüment Turk J Haematol Research Article OBJECTIVE: Hemophilia A is an X-linked recessive bleeding disorder caused by a deficiency of plasma coagulation factor VIII (FVIII), and it accounts for about 80%-85% of all cases of hemophilia. Plasma-derived therapies or recombinant FVIII concentrates are used to prevent and treat the bleeding symptoms along with FVIII-mimicking antibodies. Recently, the European Medicines Agency granted conditional marketing approval for the first gene therapy for hemophilia A. The aim of this study was to determine the effectiveness of coagulation in correcting FVIII deficiency with FVIII-secreting transgenic mesenchymal stem cells (MSCs). MATERIALS AND METHODS: A lentiviral vector encoding a B domain-deleted FVIII cDNA sequence with CD45R0 truncated (CD45R0t) surface marker was designed to develop a transgenic FVIII-expressing primary cell line by transducing MSCs. The efficacy and functionality of the FVIII secreted from the MSCs was assessed with anti-FVIII ELISA, CD45R0t flow cytometry, FVIII western blot, and mixing test analysis in vitro. RESULTS: The findings of this study showed that the transgenic MSCs maintained persistent FVIII secretion. There was no significant difference in FVIII secretion over time, suggesting stable FVIII expression from the MSCs. The functionality of the FVIII protein secreted in the MSC supernatant was demonstrated by applying a mixing test in coagulation analysis. In the mixing test analysis, FVIII-deficient human plasma products were mixed with either a saline control or FVIII-secreted MSC supernatant. The mean FVIII level of the saline control group was 0.41±0.03 IU/dL, whereas the mean level was 25.41±33.38 IU/dL in the FVIII-secreting MSC supernatant mixed group (p<0.01). The mean activated partial thromboplastin time (aPTT) of the saline control group was 92.69±11.38 s, while in the FVIII-secreting MSC supernatant mixed group, the mean aPTT level decreased to 38.60±13.38 s (p<0.001). CONCLUSION: The findings of this in vitro study suggest that the new method presented here is promising as a possible treatment for hemophilia A. Accordingly, a study of FVIII-secreting transgenic MSCs will next be initiated in a FVIII-knockout animal model. Galenos Publishing 2023-06 2023-05-29 /pmc/articles/PMC10240160/ /pubmed/37022209 http://dx.doi.org/10.4274/tjh.galenos.2023.2022-0318 Text en © Copyright 2023 by Turkish Society of Hematology / Turkish Journal of Hematology, Published by Galenos Publishing House. https://creativecommons.org/licenses/by-nc-nd/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Hemşinlioğlu, Cansu Aslan, Elif Sibel Taştan, Cihan Çakırsoy, Didem Turan, Raife Dilek Seyis, Utku Elek, Muhammer Karakuş, Gözde Sır Günaydın, Ömür Selin Abanuz, Selen Kançağı, Derya Dilek Yurtsever, Bulut Yalçın, Koray Kasap, Murat Ovalı, Ercüment In Vitro FVIII-Encoding Transgenic Mesenchymal Stem Cells Maintain Successful Coagulation in FVIII-Deficient Plasma Mimicking Hemophilia A |
title | In Vitro FVIII-Encoding Transgenic Mesenchymal Stem Cells Maintain Successful Coagulation in FVIII-Deficient Plasma Mimicking Hemophilia A |
title_full | In Vitro FVIII-Encoding Transgenic Mesenchymal Stem Cells Maintain Successful Coagulation in FVIII-Deficient Plasma Mimicking Hemophilia A |
title_fullStr | In Vitro FVIII-Encoding Transgenic Mesenchymal Stem Cells Maintain Successful Coagulation in FVIII-Deficient Plasma Mimicking Hemophilia A |
title_full_unstemmed | In Vitro FVIII-Encoding Transgenic Mesenchymal Stem Cells Maintain Successful Coagulation in FVIII-Deficient Plasma Mimicking Hemophilia A |
title_short | In Vitro FVIII-Encoding Transgenic Mesenchymal Stem Cells Maintain Successful Coagulation in FVIII-Deficient Plasma Mimicking Hemophilia A |
title_sort | in vitro fviii-encoding transgenic mesenchymal stem cells maintain successful coagulation in fviii-deficient plasma mimicking hemophilia a |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10240160/ https://www.ncbi.nlm.nih.gov/pubmed/37022209 http://dx.doi.org/10.4274/tjh.galenos.2023.2022-0318 |
work_keys_str_mv | AT hemsinlioglucansu invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa AT aslanelifsibel invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa AT tastancihan invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa AT cakırsoydidem invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa AT turanraifedilek invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa AT seyisutku invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa AT elekmuhammer invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa AT karakusgozdesır invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa AT gunaydınomurselin invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa AT abanuzselen invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa AT kancagıderyadilek invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa AT yurtseverbulut invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa AT yalcınkoray invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa AT kasapmurat invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa AT ovalıercument invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa |