Cargando…

In Vitro FVIII-Encoding Transgenic Mesenchymal Stem Cells Maintain Successful Coagulation in FVIII-Deficient Plasma Mimicking Hemophilia A

OBJECTIVE: Hemophilia A is an X-linked recessive bleeding disorder caused by a deficiency of plasma coagulation factor VIII (FVIII), and it accounts for about 80%-85% of all cases of hemophilia. Plasma-derived therapies or recombinant FVIII concentrates are used to prevent and treat the bleeding sym...

Descripción completa

Detalles Bibliográficos
Autores principales: Hemşinlioğlu, Cansu, Aslan, Elif Sibel, Taştan, Cihan, Çakırsoy, Didem, Turan, Raife Dilek, Seyis, Utku, Elek, Muhammer, Karakuş, Gözde Sır, Günaydın, Ömür Selin, Abanuz, Selen, Kançağı, Derya Dilek, Yurtsever, Bulut, Yalçın, Koray, Kasap, Murat, Ovalı, Ercüment
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Galenos Publishing 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10240160/
https://www.ncbi.nlm.nih.gov/pubmed/37022209
http://dx.doi.org/10.4274/tjh.galenos.2023.2022-0318
_version_ 1785053690040680448
author Hemşinlioğlu, Cansu
Aslan, Elif Sibel
Taştan, Cihan
Çakırsoy, Didem
Turan, Raife Dilek
Seyis, Utku
Elek, Muhammer
Karakuş, Gözde Sır
Günaydın, Ömür Selin
Abanuz, Selen
Kançağı, Derya Dilek
Yurtsever, Bulut
Yalçın, Koray
Kasap, Murat
Ovalı, Ercüment
author_facet Hemşinlioğlu, Cansu
Aslan, Elif Sibel
Taştan, Cihan
Çakırsoy, Didem
Turan, Raife Dilek
Seyis, Utku
Elek, Muhammer
Karakuş, Gözde Sır
Günaydın, Ömür Selin
Abanuz, Selen
Kançağı, Derya Dilek
Yurtsever, Bulut
Yalçın, Koray
Kasap, Murat
Ovalı, Ercüment
author_sort Hemşinlioğlu, Cansu
collection PubMed
description OBJECTIVE: Hemophilia A is an X-linked recessive bleeding disorder caused by a deficiency of plasma coagulation factor VIII (FVIII), and it accounts for about 80%-85% of all cases of hemophilia. Plasma-derived therapies or recombinant FVIII concentrates are used to prevent and treat the bleeding symptoms along with FVIII-mimicking antibodies. Recently, the European Medicines Agency granted conditional marketing approval for the first gene therapy for hemophilia A. The aim of this study was to determine the effectiveness of coagulation in correcting FVIII deficiency with FVIII-secreting transgenic mesenchymal stem cells (MSCs). MATERIALS AND METHODS: A lentiviral vector encoding a B domain-deleted FVIII cDNA sequence with CD45R0 truncated (CD45R0t) surface marker was designed to develop a transgenic FVIII-expressing primary cell line by transducing MSCs. The efficacy and functionality of the FVIII secreted from the MSCs was assessed with anti-FVIII ELISA, CD45R0t flow cytometry, FVIII western blot, and mixing test analysis in vitro. RESULTS: The findings of this study showed that the transgenic MSCs maintained persistent FVIII secretion. There was no significant difference in FVIII secretion over time, suggesting stable FVIII expression from the MSCs. The functionality of the FVIII protein secreted in the MSC supernatant was demonstrated by applying a mixing test in coagulation analysis. In the mixing test analysis, FVIII-deficient human plasma products were mixed with either a saline control or FVIII-secreted MSC supernatant. The mean FVIII level of the saline control group was 0.41±0.03 IU/dL, whereas the mean level was 25.41±33.38 IU/dL in the FVIII-secreting MSC supernatant mixed group (p<0.01). The mean activated partial thromboplastin time (aPTT) of the saline control group was 92.69±11.38 s, while in the FVIII-secreting MSC supernatant mixed group, the mean aPTT level decreased to 38.60±13.38 s (p<0.001). CONCLUSION: The findings of this in vitro study suggest that the new method presented here is promising as a possible treatment for hemophilia A. Accordingly, a study of FVIII-secreting transgenic MSCs will next be initiated in a FVIII-knockout animal model.
format Online
Article
Text
id pubmed-10240160
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher Galenos Publishing
record_format MEDLINE/PubMed
spelling pubmed-102401602023-06-06 In Vitro FVIII-Encoding Transgenic Mesenchymal Stem Cells Maintain Successful Coagulation in FVIII-Deficient Plasma Mimicking Hemophilia A Hemşinlioğlu, Cansu Aslan, Elif Sibel Taştan, Cihan Çakırsoy, Didem Turan, Raife Dilek Seyis, Utku Elek, Muhammer Karakuş, Gözde Sır Günaydın, Ömür Selin Abanuz, Selen Kançağı, Derya Dilek Yurtsever, Bulut Yalçın, Koray Kasap, Murat Ovalı, Ercüment Turk J Haematol Research Article OBJECTIVE: Hemophilia A is an X-linked recessive bleeding disorder caused by a deficiency of plasma coagulation factor VIII (FVIII), and it accounts for about 80%-85% of all cases of hemophilia. Plasma-derived therapies or recombinant FVIII concentrates are used to prevent and treat the bleeding symptoms along with FVIII-mimicking antibodies. Recently, the European Medicines Agency granted conditional marketing approval for the first gene therapy for hemophilia A. The aim of this study was to determine the effectiveness of coagulation in correcting FVIII deficiency with FVIII-secreting transgenic mesenchymal stem cells (MSCs). MATERIALS AND METHODS: A lentiviral vector encoding a B domain-deleted FVIII cDNA sequence with CD45R0 truncated (CD45R0t) surface marker was designed to develop a transgenic FVIII-expressing primary cell line by transducing MSCs. The efficacy and functionality of the FVIII secreted from the MSCs was assessed with anti-FVIII ELISA, CD45R0t flow cytometry, FVIII western blot, and mixing test analysis in vitro. RESULTS: The findings of this study showed that the transgenic MSCs maintained persistent FVIII secretion. There was no significant difference in FVIII secretion over time, suggesting stable FVIII expression from the MSCs. The functionality of the FVIII protein secreted in the MSC supernatant was demonstrated by applying a mixing test in coagulation analysis. In the mixing test analysis, FVIII-deficient human plasma products were mixed with either a saline control or FVIII-secreted MSC supernatant. The mean FVIII level of the saline control group was 0.41±0.03 IU/dL, whereas the mean level was 25.41±33.38 IU/dL in the FVIII-secreting MSC supernatant mixed group (p<0.01). The mean activated partial thromboplastin time (aPTT) of the saline control group was 92.69±11.38 s, while in the FVIII-secreting MSC supernatant mixed group, the mean aPTT level decreased to 38.60±13.38 s (p<0.001). CONCLUSION: The findings of this in vitro study suggest that the new method presented here is promising as a possible treatment for hemophilia A. Accordingly, a study of FVIII-secreting transgenic MSCs will next be initiated in a FVIII-knockout animal model. Galenos Publishing 2023-06 2023-05-29 /pmc/articles/PMC10240160/ /pubmed/37022209 http://dx.doi.org/10.4274/tjh.galenos.2023.2022-0318 Text en © Copyright 2023 by Turkish Society of Hematology / Turkish Journal of Hematology, Published by Galenos Publishing House. https://creativecommons.org/licenses/by-nc-nd/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Article
Hemşinlioğlu, Cansu
Aslan, Elif Sibel
Taştan, Cihan
Çakırsoy, Didem
Turan, Raife Dilek
Seyis, Utku
Elek, Muhammer
Karakuş, Gözde Sır
Günaydın, Ömür Selin
Abanuz, Selen
Kançağı, Derya Dilek
Yurtsever, Bulut
Yalçın, Koray
Kasap, Murat
Ovalı, Ercüment
In Vitro FVIII-Encoding Transgenic Mesenchymal Stem Cells Maintain Successful Coagulation in FVIII-Deficient Plasma Mimicking Hemophilia A
title In Vitro FVIII-Encoding Transgenic Mesenchymal Stem Cells Maintain Successful Coagulation in FVIII-Deficient Plasma Mimicking Hemophilia A
title_full In Vitro FVIII-Encoding Transgenic Mesenchymal Stem Cells Maintain Successful Coagulation in FVIII-Deficient Plasma Mimicking Hemophilia A
title_fullStr In Vitro FVIII-Encoding Transgenic Mesenchymal Stem Cells Maintain Successful Coagulation in FVIII-Deficient Plasma Mimicking Hemophilia A
title_full_unstemmed In Vitro FVIII-Encoding Transgenic Mesenchymal Stem Cells Maintain Successful Coagulation in FVIII-Deficient Plasma Mimicking Hemophilia A
title_short In Vitro FVIII-Encoding Transgenic Mesenchymal Stem Cells Maintain Successful Coagulation in FVIII-Deficient Plasma Mimicking Hemophilia A
title_sort in vitro fviii-encoding transgenic mesenchymal stem cells maintain successful coagulation in fviii-deficient plasma mimicking hemophilia a
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10240160/
https://www.ncbi.nlm.nih.gov/pubmed/37022209
http://dx.doi.org/10.4274/tjh.galenos.2023.2022-0318
work_keys_str_mv AT hemsinlioglucansu invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa
AT aslanelifsibel invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa
AT tastancihan invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa
AT cakırsoydidem invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa
AT turanraifedilek invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa
AT seyisutku invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa
AT elekmuhammer invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa
AT karakusgozdesır invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa
AT gunaydınomurselin invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa
AT abanuzselen invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa
AT kancagıderyadilek invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa
AT yurtseverbulut invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa
AT yalcınkoray invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa
AT kasapmurat invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa
AT ovalıercument invitrofviiiencodingtransgenicmesenchymalstemcellsmaintainsuccessfulcoagulationinfviiideficientplasmamimickinghemophiliaa