Cargando…
Cytotoxicity of CD19-CAR-NK92 cells is primarily mediated via perforin/granzyme pathway
Chimeric antigen receptors (CARs) have improved cancer immunotherapy in recent years. Immune cells, such as Natural killer cells (NK-cells) or T cells, are used as effector cells in CAR-therapy. NK92-cells, a cell line with known cytotoxic activity, are of particular interest in CAR-therapy since cu...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Springer Berlin Heidelberg
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10361870/ https://www.ncbi.nlm.nih.gov/pubmed/37052701 http://dx.doi.org/10.1007/s00262-023-03443-1 |
_version_ | 1785076303613919232 |
---|---|
author | Althaus, Jonas Nilius-Eliliwi, Verena Maghnouj, Abdelouahid Döring, Sascha Schroers, Roland Hudecek, Michael Hahn, Stephan A. Mika, Thomas |
author_facet | Althaus, Jonas Nilius-Eliliwi, Verena Maghnouj, Abdelouahid Döring, Sascha Schroers, Roland Hudecek, Michael Hahn, Stephan A. Mika, Thomas |
author_sort | Althaus, Jonas |
collection | PubMed |
description | Chimeric antigen receptors (CARs) have improved cancer immunotherapy in recent years. Immune cells, such as Natural killer cells (NK-cells) or T cells, are used as effector cells in CAR-therapy. NK92-cells, a cell line with known cytotoxic activity, are of particular interest in CAR-therapy since culturing conditions are simple and anti-tumor efficacy combined with a manageable safety profile was proven in clinical trials. The major pathways of immune effector cells, including NK92-cells, to mediate cytotoxicity, are the perforin/granzyme and the death-receptor pathway. Detailed knowledge of CAR-effector cells’ cytotoxic mechanisms is essential to unravel resistance mechanisms, which potentially arise by resistance against apoptosis-inducing signaling. Since mutations in apoptosis pathways are frequent in lymphoma, the impact on CAR-mediated cytotoxicity is of clinical interest. In this study, knockout models of CD19-CAR-NK92 cells were designed, to investigate cytotoxic pathways in vitro. Knockout of perforin 1 (Prf1) and subsequent abrogation of the perforin/granzyme pathway dramatically reduced the cytotoxicity of CD19-CAR-NK92 cells. In contrast, knockout of FasL and inhibition of TRAIL (tumor necrosis factor-related apoptosis-inducing ligands) did not impair cytotoxicity in most conditions. In conclusion, these results indicate the perforin/granzyme pathway as the major pathway to mediate cytotoxicity in CD19-CAR-NK92 cells. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1007/s00262-023-03443-1. |
format | Online Article Text |
id | pubmed-10361870 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Springer Berlin Heidelberg |
record_format | MEDLINE/PubMed |
spelling | pubmed-103618702023-07-23 Cytotoxicity of CD19-CAR-NK92 cells is primarily mediated via perforin/granzyme pathway Althaus, Jonas Nilius-Eliliwi, Verena Maghnouj, Abdelouahid Döring, Sascha Schroers, Roland Hudecek, Michael Hahn, Stephan A. Mika, Thomas Cancer Immunol Immunother Research Chimeric antigen receptors (CARs) have improved cancer immunotherapy in recent years. Immune cells, such as Natural killer cells (NK-cells) or T cells, are used as effector cells in CAR-therapy. NK92-cells, a cell line with known cytotoxic activity, are of particular interest in CAR-therapy since culturing conditions are simple and anti-tumor efficacy combined with a manageable safety profile was proven in clinical trials. The major pathways of immune effector cells, including NK92-cells, to mediate cytotoxicity, are the perforin/granzyme and the death-receptor pathway. Detailed knowledge of CAR-effector cells’ cytotoxic mechanisms is essential to unravel resistance mechanisms, which potentially arise by resistance against apoptosis-inducing signaling. Since mutations in apoptosis pathways are frequent in lymphoma, the impact on CAR-mediated cytotoxicity is of clinical interest. In this study, knockout models of CD19-CAR-NK92 cells were designed, to investigate cytotoxic pathways in vitro. Knockout of perforin 1 (Prf1) and subsequent abrogation of the perforin/granzyme pathway dramatically reduced the cytotoxicity of CD19-CAR-NK92 cells. In contrast, knockout of FasL and inhibition of TRAIL (tumor necrosis factor-related apoptosis-inducing ligands) did not impair cytotoxicity in most conditions. In conclusion, these results indicate the perforin/granzyme pathway as the major pathway to mediate cytotoxicity in CD19-CAR-NK92 cells. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1007/s00262-023-03443-1. Springer Berlin Heidelberg 2023-04-13 2023 /pmc/articles/PMC10361870/ /pubmed/37052701 http://dx.doi.org/10.1007/s00262-023-03443-1 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . |
spellingShingle | Research Althaus, Jonas Nilius-Eliliwi, Verena Maghnouj, Abdelouahid Döring, Sascha Schroers, Roland Hudecek, Michael Hahn, Stephan A. Mika, Thomas Cytotoxicity of CD19-CAR-NK92 cells is primarily mediated via perforin/granzyme pathway |
title | Cytotoxicity of CD19-CAR-NK92 cells is primarily mediated via perforin/granzyme pathway |
title_full | Cytotoxicity of CD19-CAR-NK92 cells is primarily mediated via perforin/granzyme pathway |
title_fullStr | Cytotoxicity of CD19-CAR-NK92 cells is primarily mediated via perforin/granzyme pathway |
title_full_unstemmed | Cytotoxicity of CD19-CAR-NK92 cells is primarily mediated via perforin/granzyme pathway |
title_short | Cytotoxicity of CD19-CAR-NK92 cells is primarily mediated via perforin/granzyme pathway |
title_sort | cytotoxicity of cd19-car-nk92 cells is primarily mediated via perforin/granzyme pathway |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10361870/ https://www.ncbi.nlm.nih.gov/pubmed/37052701 http://dx.doi.org/10.1007/s00262-023-03443-1 |
work_keys_str_mv | AT althausjonas cytotoxicityofcd19carnk92cellsisprimarilymediatedviaperforingranzymepathway AT niliuseliliwiverena cytotoxicityofcd19carnk92cellsisprimarilymediatedviaperforingranzymepathway AT maghnoujabdelouahid cytotoxicityofcd19carnk92cellsisprimarilymediatedviaperforingranzymepathway AT doringsascha cytotoxicityofcd19carnk92cellsisprimarilymediatedviaperforingranzymepathway AT schroersroland cytotoxicityofcd19carnk92cellsisprimarilymediatedviaperforingranzymepathway AT hudecekmichael cytotoxicityofcd19carnk92cellsisprimarilymediatedviaperforingranzymepathway AT hahnstephana cytotoxicityofcd19carnk92cellsisprimarilymediatedviaperforingranzymepathway AT mikathomas cytotoxicityofcd19carnk92cellsisprimarilymediatedviaperforingranzymepathway |