Cargando…
A programmable pAgo nuclease with RNA target-cleavage specificity from the mesophilic bacterium Verrucomicrobia : A pAgo with RNA target cleavage specificity
Argonaute (Ago) proteins are conserved programmable nucleases present in eukaryotes and prokaryotes and provide defense against mobile genetic elements. Almost all characterized pAgos prefer to cleave DNA targets. Here, we describe a novel pAgo from Verrucomicrobia bacterium (VbAgo) that can specifi...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Oxford University Press
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10448046/ https://www.ncbi.nlm.nih.gov/pubmed/37431184 http://dx.doi.org/10.3724/abbs.2023110 |
_version_ | 1785094637341376512 |
---|---|
author | Liu, Qi Chen, Wanping Zhang, Yue Hu, Fengyang Jiang, Xiaoman Wang, Fei Liu, Yang Ma, Lixin |
author_facet | Liu, Qi Chen, Wanping Zhang, Yue Hu, Fengyang Jiang, Xiaoman Wang, Fei Liu, Yang Ma, Lixin |
author_sort | Liu, Qi |
collection | PubMed |
description | Argonaute (Ago) proteins are conserved programmable nucleases present in eukaryotes and prokaryotes and provide defense against mobile genetic elements. Almost all characterized pAgos prefer to cleave DNA targets. Here, we describe a novel pAgo from Verrucomicrobia bacterium (VbAgo) that can specifically cleave RNA targets rather than DNA targets at 37°C and function as a multiple-turnover enzyme showing prominent catalytic capacity. VbAgo utilizes DNA guides (gDNAs) to cleave RNA targets at the canonical cleavage site. Meanwhile, the cleavage activity is remarkably strengthened at low concentrations of NaCl. In addition, VbAgo presents a weak tolerance for mismatches between gDNAs and RNA targets, and single-nucleotide mismatches at positions 11‒12 and dinucleotide mismatches at positions 3‒15 dramatically reduce target cleavage. Moreover, VbAgo can efficiently cleave highly structured RNA targets at 37°C. These properties of VbAgo broaden our understanding of Ago proteins and expand the pAgo-based RNA manipulation toolbox. |
format | Online Article Text |
id | pubmed-10448046 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Oxford University Press |
record_format | MEDLINE/PubMed |
spelling | pubmed-104480462023-08-25 A programmable pAgo nuclease with RNA target-cleavage specificity from the mesophilic bacterium Verrucomicrobia : A pAgo with RNA target cleavage specificity Liu, Qi Chen, Wanping Zhang, Yue Hu, Fengyang Jiang, Xiaoman Wang, Fei Liu, Yang Ma, Lixin Acta Biochim Biophys Sin (Shanghai) Research Article Argonaute (Ago) proteins are conserved programmable nucleases present in eukaryotes and prokaryotes and provide defense against mobile genetic elements. Almost all characterized pAgos prefer to cleave DNA targets. Here, we describe a novel pAgo from Verrucomicrobia bacterium (VbAgo) that can specifically cleave RNA targets rather than DNA targets at 37°C and function as a multiple-turnover enzyme showing prominent catalytic capacity. VbAgo utilizes DNA guides (gDNAs) to cleave RNA targets at the canonical cleavage site. Meanwhile, the cleavage activity is remarkably strengthened at low concentrations of NaCl. In addition, VbAgo presents a weak tolerance for mismatches between gDNAs and RNA targets, and single-nucleotide mismatches at positions 11‒12 and dinucleotide mismatches at positions 3‒15 dramatically reduce target cleavage. Moreover, VbAgo can efficiently cleave highly structured RNA targets at 37°C. These properties of VbAgo broaden our understanding of Ago proteins and expand the pAgo-based RNA manipulation toolbox. Oxford University Press 2023-07-10 /pmc/articles/PMC10448046/ /pubmed/37431184 http://dx.doi.org/10.3724/abbs.2023110 Text en © The Author(s) 2021. 0 https://creativecommons.org/licenses/by-nc/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution Non-Commercial Licence (https://creativecommons.org/licenses/by-nc/4.0/). |
spellingShingle | Research Article Liu, Qi Chen, Wanping Zhang, Yue Hu, Fengyang Jiang, Xiaoman Wang, Fei Liu, Yang Ma, Lixin A programmable pAgo nuclease with RNA target-cleavage specificity from the mesophilic bacterium Verrucomicrobia : A pAgo with RNA target cleavage specificity |
title | A programmable pAgo nuclease with RNA target-cleavage specificity from the mesophilic bacterium
Verrucomicrobia
: A pAgo with RNA target cleavage specificity |
title_full | A programmable pAgo nuclease with RNA target-cleavage specificity from the mesophilic bacterium
Verrucomicrobia
: A pAgo with RNA target cleavage specificity |
title_fullStr | A programmable pAgo nuclease with RNA target-cleavage specificity from the mesophilic bacterium
Verrucomicrobia
: A pAgo with RNA target cleavage specificity |
title_full_unstemmed | A programmable pAgo nuclease with RNA target-cleavage specificity from the mesophilic bacterium
Verrucomicrobia
: A pAgo with RNA target cleavage specificity |
title_short | A programmable pAgo nuclease with RNA target-cleavage specificity from the mesophilic bacterium
Verrucomicrobia
: A pAgo with RNA target cleavage specificity |
title_sort | programmable pago nuclease with rna target-cleavage specificity from the mesophilic bacterium
verrucomicrobia
: a pago with rna target cleavage specificity |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10448046/ https://www.ncbi.nlm.nih.gov/pubmed/37431184 http://dx.doi.org/10.3724/abbs.2023110 |
work_keys_str_mv | AT liuqi aprogrammablepagonucleasewithrnatargetcleavagespecificityfromthemesophilicbacteriumverrucomicrobiaapagowithrnatargetcleavagespecificity AT chenwanping aprogrammablepagonucleasewithrnatargetcleavagespecificityfromthemesophilicbacteriumverrucomicrobiaapagowithrnatargetcleavagespecificity AT zhangyue aprogrammablepagonucleasewithrnatargetcleavagespecificityfromthemesophilicbacteriumverrucomicrobiaapagowithrnatargetcleavagespecificity AT hufengyang aprogrammablepagonucleasewithrnatargetcleavagespecificityfromthemesophilicbacteriumverrucomicrobiaapagowithrnatargetcleavagespecificity AT jiangxiaoman aprogrammablepagonucleasewithrnatargetcleavagespecificityfromthemesophilicbacteriumverrucomicrobiaapagowithrnatargetcleavagespecificity AT wangfei aprogrammablepagonucleasewithrnatargetcleavagespecificityfromthemesophilicbacteriumverrucomicrobiaapagowithrnatargetcleavagespecificity AT liuyang aprogrammablepagonucleasewithrnatargetcleavagespecificityfromthemesophilicbacteriumverrucomicrobiaapagowithrnatargetcleavagespecificity AT malixin aprogrammablepagonucleasewithrnatargetcleavagespecificityfromthemesophilicbacteriumverrucomicrobiaapagowithrnatargetcleavagespecificity AT liuqi programmablepagonucleasewithrnatargetcleavagespecificityfromthemesophilicbacteriumverrucomicrobiaapagowithrnatargetcleavagespecificity AT chenwanping programmablepagonucleasewithrnatargetcleavagespecificityfromthemesophilicbacteriumverrucomicrobiaapagowithrnatargetcleavagespecificity AT zhangyue programmablepagonucleasewithrnatargetcleavagespecificityfromthemesophilicbacteriumverrucomicrobiaapagowithrnatargetcleavagespecificity AT hufengyang programmablepagonucleasewithrnatargetcleavagespecificityfromthemesophilicbacteriumverrucomicrobiaapagowithrnatargetcleavagespecificity AT jiangxiaoman programmablepagonucleasewithrnatargetcleavagespecificityfromthemesophilicbacteriumverrucomicrobiaapagowithrnatargetcleavagespecificity AT wangfei programmablepagonucleasewithrnatargetcleavagespecificityfromthemesophilicbacteriumverrucomicrobiaapagowithrnatargetcleavagespecificity AT liuyang programmablepagonucleasewithrnatargetcleavagespecificityfromthemesophilicbacteriumverrucomicrobiaapagowithrnatargetcleavagespecificity AT malixin programmablepagonucleasewithrnatargetcleavagespecificityfromthemesophilicbacteriumverrucomicrobiaapagowithrnatargetcleavagespecificity |