Cargando…

DNA Methylation Signatures of Multiple Sclerosis Occur Independently of Known Genetic Risk and Are Primarily Attributed to B Cells and Monocytes

Epigenetic mechanisms can regulate how DNA is expressed independently of sequence and are known to be associated with various diseases. Among those epigenetic mechanisms, DNA methylation (DNAm) is influenced by genotype and the environment, making it an important molecular interface for studying dis...

Descripción completa

Detalles Bibliográficos
Autores principales: Xavier, Alexandre, Maltby, Vicki E., Ewing, Ewoud, Campagna, Maria Pia, Burnard, Sean M., Tegner, Jesper N., Slee, Mark, Butzkueven, Helmut, Kockum, Ingrid, Kular, Lara, Jokubaitis, Vilija G., Kilpatrick, Trevor, Alfredsson, Lars, Jagodic, Maja, Ponsonby, Anne-Louise, Taylor, Bruce V., Scott, Rodney J., Lea, Rodney A., Lechner-Scott, Jeannette
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10454485/
https://www.ncbi.nlm.nih.gov/pubmed/37628757
http://dx.doi.org/10.3390/ijms241612576
_version_ 1785096205225689088
author Xavier, Alexandre
Maltby, Vicki E.
Ewing, Ewoud
Campagna, Maria Pia
Burnard, Sean M.
Tegner, Jesper N.
Slee, Mark
Butzkueven, Helmut
Kockum, Ingrid
Kular, Lara
Jokubaitis, Vilija G.
Kilpatrick, Trevor
Alfredsson, Lars
Jagodic, Maja
Ponsonby, Anne-Louise
Taylor, Bruce V.
Scott, Rodney J.
Lea, Rodney A.
Lechner-Scott, Jeannette
author_facet Xavier, Alexandre
Maltby, Vicki E.
Ewing, Ewoud
Campagna, Maria Pia
Burnard, Sean M.
Tegner, Jesper N.
Slee, Mark
Butzkueven, Helmut
Kockum, Ingrid
Kular, Lara
Jokubaitis, Vilija G.
Kilpatrick, Trevor
Alfredsson, Lars
Jagodic, Maja
Ponsonby, Anne-Louise
Taylor, Bruce V.
Scott, Rodney J.
Lea, Rodney A.
Lechner-Scott, Jeannette
author_sort Xavier, Alexandre
collection PubMed
description Epigenetic mechanisms can regulate how DNA is expressed independently of sequence and are known to be associated with various diseases. Among those epigenetic mechanisms, DNA methylation (DNAm) is influenced by genotype and the environment, making it an important molecular interface for studying disease etiology and progression. In this study, we examined the whole blood DNA methylation profiles of a large group of people with (pw) multiple sclerosis (MS) compared to those of controls. We reveal that methylation differences in pwMS occur independently of known genetic risk loci and show that they more strongly differentiate disease (AUC = 0.85, 95% CI 0.82–0.89, p = 1.22 × 10(−29)) than known genetic risk loci (AUC = 0.72, 95% CI: 0.66–0.76, p = 9.07 × 10(−17)). We also show that methylation differences in MS occur predominantly in B cells and monocytes and indicate the involvement of cell-specific biological pathways. Overall, this study comprehensively characterizes the immune cell-specific epigenetic architecture of MS.
format Online
Article
Text
id pubmed-10454485
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-104544852023-08-26 DNA Methylation Signatures of Multiple Sclerosis Occur Independently of Known Genetic Risk and Are Primarily Attributed to B Cells and Monocytes Xavier, Alexandre Maltby, Vicki E. Ewing, Ewoud Campagna, Maria Pia Burnard, Sean M. Tegner, Jesper N. Slee, Mark Butzkueven, Helmut Kockum, Ingrid Kular, Lara Jokubaitis, Vilija G. Kilpatrick, Trevor Alfredsson, Lars Jagodic, Maja Ponsonby, Anne-Louise Taylor, Bruce V. Scott, Rodney J. Lea, Rodney A. Lechner-Scott, Jeannette Int J Mol Sci Article Epigenetic mechanisms can regulate how DNA is expressed independently of sequence and are known to be associated with various diseases. Among those epigenetic mechanisms, DNA methylation (DNAm) is influenced by genotype and the environment, making it an important molecular interface for studying disease etiology and progression. In this study, we examined the whole blood DNA methylation profiles of a large group of people with (pw) multiple sclerosis (MS) compared to those of controls. We reveal that methylation differences in pwMS occur independently of known genetic risk loci and show that they more strongly differentiate disease (AUC = 0.85, 95% CI 0.82–0.89, p = 1.22 × 10(−29)) than known genetic risk loci (AUC = 0.72, 95% CI: 0.66–0.76, p = 9.07 × 10(−17)). We also show that methylation differences in MS occur predominantly in B cells and monocytes and indicate the involvement of cell-specific biological pathways. Overall, this study comprehensively characterizes the immune cell-specific epigenetic architecture of MS. MDPI 2023-08-08 /pmc/articles/PMC10454485/ /pubmed/37628757 http://dx.doi.org/10.3390/ijms241612576 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Xavier, Alexandre
Maltby, Vicki E.
Ewing, Ewoud
Campagna, Maria Pia
Burnard, Sean M.
Tegner, Jesper N.
Slee, Mark
Butzkueven, Helmut
Kockum, Ingrid
Kular, Lara
Jokubaitis, Vilija G.
Kilpatrick, Trevor
Alfredsson, Lars
Jagodic, Maja
Ponsonby, Anne-Louise
Taylor, Bruce V.
Scott, Rodney J.
Lea, Rodney A.
Lechner-Scott, Jeannette
DNA Methylation Signatures of Multiple Sclerosis Occur Independently of Known Genetic Risk and Are Primarily Attributed to B Cells and Monocytes
title DNA Methylation Signatures of Multiple Sclerosis Occur Independently of Known Genetic Risk and Are Primarily Attributed to B Cells and Monocytes
title_full DNA Methylation Signatures of Multiple Sclerosis Occur Independently of Known Genetic Risk and Are Primarily Attributed to B Cells and Monocytes
title_fullStr DNA Methylation Signatures of Multiple Sclerosis Occur Independently of Known Genetic Risk and Are Primarily Attributed to B Cells and Monocytes
title_full_unstemmed DNA Methylation Signatures of Multiple Sclerosis Occur Independently of Known Genetic Risk and Are Primarily Attributed to B Cells and Monocytes
title_short DNA Methylation Signatures of Multiple Sclerosis Occur Independently of Known Genetic Risk and Are Primarily Attributed to B Cells and Monocytes
title_sort dna methylation signatures of multiple sclerosis occur independently of known genetic risk and are primarily attributed to b cells and monocytes
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10454485/
https://www.ncbi.nlm.nih.gov/pubmed/37628757
http://dx.doi.org/10.3390/ijms241612576
work_keys_str_mv AT xavieralexandre dnamethylationsignaturesofmultiplesclerosisoccurindependentlyofknowngeneticriskandareprimarilyattributedtobcellsandmonocytes
AT maltbyvickie dnamethylationsignaturesofmultiplesclerosisoccurindependentlyofknowngeneticriskandareprimarilyattributedtobcellsandmonocytes
AT ewingewoud dnamethylationsignaturesofmultiplesclerosisoccurindependentlyofknowngeneticriskandareprimarilyattributedtobcellsandmonocytes
AT campagnamariapia dnamethylationsignaturesofmultiplesclerosisoccurindependentlyofknowngeneticriskandareprimarilyattributedtobcellsandmonocytes
AT burnardseanm dnamethylationsignaturesofmultiplesclerosisoccurindependentlyofknowngeneticriskandareprimarilyattributedtobcellsandmonocytes
AT tegnerjespern dnamethylationsignaturesofmultiplesclerosisoccurindependentlyofknowngeneticriskandareprimarilyattributedtobcellsandmonocytes
AT sleemark dnamethylationsignaturesofmultiplesclerosisoccurindependentlyofknowngeneticriskandareprimarilyattributedtobcellsandmonocytes
AT butzkuevenhelmut dnamethylationsignaturesofmultiplesclerosisoccurindependentlyofknowngeneticriskandareprimarilyattributedtobcellsandmonocytes
AT kockumingrid dnamethylationsignaturesofmultiplesclerosisoccurindependentlyofknowngeneticriskandareprimarilyattributedtobcellsandmonocytes
AT kularlara dnamethylationsignaturesofmultiplesclerosisoccurindependentlyofknowngeneticriskandareprimarilyattributedtobcellsandmonocytes
AT dnamethylationsignaturesofmultiplesclerosisoccurindependentlyofknowngeneticriskandareprimarilyattributedtobcellsandmonocytes
AT jokubaitisvilijag dnamethylationsignaturesofmultiplesclerosisoccurindependentlyofknowngeneticriskandareprimarilyattributedtobcellsandmonocytes
AT kilpatricktrevor dnamethylationsignaturesofmultiplesclerosisoccurindependentlyofknowngeneticriskandareprimarilyattributedtobcellsandmonocytes
AT alfredssonlars dnamethylationsignaturesofmultiplesclerosisoccurindependentlyofknowngeneticriskandareprimarilyattributedtobcellsandmonocytes
AT jagodicmaja dnamethylationsignaturesofmultiplesclerosisoccurindependentlyofknowngeneticriskandareprimarilyattributedtobcellsandmonocytes
AT ponsonbyannelouise dnamethylationsignaturesofmultiplesclerosisoccurindependentlyofknowngeneticriskandareprimarilyattributedtobcellsandmonocytes
AT taylorbrucev dnamethylationsignaturesofmultiplesclerosisoccurindependentlyofknowngeneticriskandareprimarilyattributedtobcellsandmonocytes
AT scottrodneyj dnamethylationsignaturesofmultiplesclerosisoccurindependentlyofknowngeneticriskandareprimarilyattributedtobcellsandmonocytes
AT learodneya dnamethylationsignaturesofmultiplesclerosisoccurindependentlyofknowngeneticriskandareprimarilyattributedtobcellsandmonocytes
AT lechnerscottjeannette dnamethylationsignaturesofmultiplesclerosisoccurindependentlyofknowngeneticriskandareprimarilyattributedtobcellsandmonocytes