Cargando…
The kynurenine pathway in HIV, frailty and inflammaging
Kynurenine (Kyn) is a circulating tryptophan (Trp) catabolite generated by enzymes including IDO1 that are induced by inflammatory cytokines such as interferon-gamma. Kyn levels in circulation increase with age and Kyn is implicated in several age-related disorders including neurodegeneration, osteo...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10514395/ https://www.ncbi.nlm.nih.gov/pubmed/37744363 http://dx.doi.org/10.3389/fimmu.2023.1244622 |
_version_ | 1785108717977468928 |
---|---|
author | Sultana, Shabiha Elengickal, Anthony Bensreti, Husam de Chantemèle, Eric Belin McGee-Lawrence, Meghan E. Hamrick, Mark W. |
author_facet | Sultana, Shabiha Elengickal, Anthony Bensreti, Husam de Chantemèle, Eric Belin McGee-Lawrence, Meghan E. Hamrick, Mark W. |
author_sort | Sultana, Shabiha |
collection | PubMed |
description | Kynurenine (Kyn) is a circulating tryptophan (Trp) catabolite generated by enzymes including IDO1 that are induced by inflammatory cytokines such as interferon-gamma. Kyn levels in circulation increase with age and Kyn is implicated in several age-related disorders including neurodegeneration, osteoporosis, and sarcopenia. Importantly, Kyn increases with progressive disease in HIV patients, and antiretroviral therapy does not normalize IDO1 activity in these subjects. Kyn is now recognized as an endogenous agonist of the aryl hydrocarbon receptor, and AhR activation itself has been found to induce muscle atrophy, increase the activity of bone-resorbing osteoclasts, decrease matrix formation by osteoblasts, and lead to senescence of bone marrow stem cells. Several IDO1 and AhR inhibitors are now in clinical trials as potential cancer therapies. We propose that some of these drugs may be repurposed to improve musculoskeletal health in older adults living with HIV. |
format | Online Article Text |
id | pubmed-10514395 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-105143952023-09-23 The kynurenine pathway in HIV, frailty and inflammaging Sultana, Shabiha Elengickal, Anthony Bensreti, Husam de Chantemèle, Eric Belin McGee-Lawrence, Meghan E. Hamrick, Mark W. Front Immunol Immunology Kynurenine (Kyn) is a circulating tryptophan (Trp) catabolite generated by enzymes including IDO1 that are induced by inflammatory cytokines such as interferon-gamma. Kyn levels in circulation increase with age and Kyn is implicated in several age-related disorders including neurodegeneration, osteoporosis, and sarcopenia. Importantly, Kyn increases with progressive disease in HIV patients, and antiretroviral therapy does not normalize IDO1 activity in these subjects. Kyn is now recognized as an endogenous agonist of the aryl hydrocarbon receptor, and AhR activation itself has been found to induce muscle atrophy, increase the activity of bone-resorbing osteoclasts, decrease matrix formation by osteoblasts, and lead to senescence of bone marrow stem cells. Several IDO1 and AhR inhibitors are now in clinical trials as potential cancer therapies. We propose that some of these drugs may be repurposed to improve musculoskeletal health in older adults living with HIV. Frontiers Media S.A. 2023-09-08 /pmc/articles/PMC10514395/ /pubmed/37744363 http://dx.doi.org/10.3389/fimmu.2023.1244622 Text en Copyright © 2023 Sultana, Elengickal, Bensreti, de Chantemèle, McGee-Lawrence and Hamrick https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Immunology Sultana, Shabiha Elengickal, Anthony Bensreti, Husam de Chantemèle, Eric Belin McGee-Lawrence, Meghan E. Hamrick, Mark W. The kynurenine pathway in HIV, frailty and inflammaging |
title | The kynurenine pathway in HIV, frailty and inflammaging |
title_full | The kynurenine pathway in HIV, frailty and inflammaging |
title_fullStr | The kynurenine pathway in HIV, frailty and inflammaging |
title_full_unstemmed | The kynurenine pathway in HIV, frailty and inflammaging |
title_short | The kynurenine pathway in HIV, frailty and inflammaging |
title_sort | kynurenine pathway in hiv, frailty and inflammaging |
topic | Immunology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10514395/ https://www.ncbi.nlm.nih.gov/pubmed/37744363 http://dx.doi.org/10.3389/fimmu.2023.1244622 |
work_keys_str_mv | AT sultanashabiha thekynureninepathwayinhivfrailtyandinflammaging AT elengickalanthony thekynureninepathwayinhivfrailtyandinflammaging AT bensretihusam thekynureninepathwayinhivfrailtyandinflammaging AT dechantemeleericbelin thekynureninepathwayinhivfrailtyandinflammaging AT mcgeelawrencemeghane thekynureninepathwayinhivfrailtyandinflammaging AT hamrickmarkw thekynureninepathwayinhivfrailtyandinflammaging AT sultanashabiha kynureninepathwayinhivfrailtyandinflammaging AT elengickalanthony kynureninepathwayinhivfrailtyandinflammaging AT bensretihusam kynureninepathwayinhivfrailtyandinflammaging AT dechantemeleericbelin kynureninepathwayinhivfrailtyandinflammaging AT mcgeelawrencemeghane kynureninepathwayinhivfrailtyandinflammaging AT hamrickmarkw kynureninepathwayinhivfrailtyandinflammaging |