Cargando…

Mutation spectrum, expression profiling, and prognosis evaluation of Fanconi anemia signaling pathway genes for 4259 patients with myelodysplastic syndromes or acute myeloid leukemia

BACKGROUND: Individuals diagnosed with Fanconi anemia (FA), an uncommon disorder characterized by chromosomal instability affecting the FA signaling pathway, exhibit heightened vulnerability to the onset of myelodysplastic syndromes (MDS) or acute myeloid leukemia (AML). METHODS: Herein, we employed...

Descripción completa

Detalles Bibliográficos
Autores principales: Chang, Lixian, Zhang, Li, Zhao, Beibei, Cheng, Xuelian, Wan, Yang, Zhang, Ranran, Yuan, Weiping, Gao, Xingjie, Zhu, Xiaofan
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10652513/
https://www.ncbi.nlm.nih.gov/pubmed/37974167
http://dx.doi.org/10.1186/s12920-023-01730-5
_version_ 1785147700956626944
author Chang, Lixian
Zhang, Li
Zhao, Beibei
Cheng, Xuelian
Wan, Yang
Zhang, Ranran
Yuan, Weiping
Gao, Xingjie
Zhu, Xiaofan
author_facet Chang, Lixian
Zhang, Li
Zhao, Beibei
Cheng, Xuelian
Wan, Yang
Zhang, Ranran
Yuan, Weiping
Gao, Xingjie
Zhu, Xiaofan
author_sort Chang, Lixian
collection PubMed
description BACKGROUND: Individuals diagnosed with Fanconi anemia (FA), an uncommon disorder characterized by chromosomal instability affecting the FA signaling pathway, exhibit heightened vulnerability to the onset of myelodysplastic syndromes (MDS) or acute myeloid leukemia (AML). METHODS: Herein, we employed diverse bioinformatics and statistical analyses to investigate the potential associations between the expression/mutation patterns of FA pathway genes and MDS/AML. RESULTS: The study included 4295 samples, comprising 3235 AML and 1024 MDS from our and nine other online cohorts. We investigated the distinct proportion of race, age, French-American-British, and gender factors. Compared to the FA wild-type group, we observed a decrease in the expression of FNACD2, FANCI, and RAD51C in the FA mutation group. The FA mutation group exhibited a more favorable clinical overall survival prognosis. We developed a random forest classifier and a decision tree based on FA gene expression for cytogenetic risk assessment. Furthermore, we created an FA-related Nomogram to predict survival rates in AML patients. CONCLUSIONS: This investigation facilitates a deeper understanding of the functional links between FA and MDS/AML. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12920-023-01730-5.
format Online
Article
Text
id pubmed-10652513
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-106525132023-11-16 Mutation spectrum, expression profiling, and prognosis evaluation of Fanconi anemia signaling pathway genes for 4259 patients with myelodysplastic syndromes or acute myeloid leukemia Chang, Lixian Zhang, Li Zhao, Beibei Cheng, Xuelian Wan, Yang Zhang, Ranran Yuan, Weiping Gao, Xingjie Zhu, Xiaofan BMC Med Genomics Research BACKGROUND: Individuals diagnosed with Fanconi anemia (FA), an uncommon disorder characterized by chromosomal instability affecting the FA signaling pathway, exhibit heightened vulnerability to the onset of myelodysplastic syndromes (MDS) or acute myeloid leukemia (AML). METHODS: Herein, we employed diverse bioinformatics and statistical analyses to investigate the potential associations between the expression/mutation patterns of FA pathway genes and MDS/AML. RESULTS: The study included 4295 samples, comprising 3235 AML and 1024 MDS from our and nine other online cohorts. We investigated the distinct proportion of race, age, French-American-British, and gender factors. Compared to the FA wild-type group, we observed a decrease in the expression of FNACD2, FANCI, and RAD51C in the FA mutation group. The FA mutation group exhibited a more favorable clinical overall survival prognosis. We developed a random forest classifier and a decision tree based on FA gene expression for cytogenetic risk assessment. Furthermore, we created an FA-related Nomogram to predict survival rates in AML patients. CONCLUSIONS: This investigation facilitates a deeper understanding of the functional links between FA and MDS/AML. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12920-023-01730-5. BioMed Central 2023-11-16 /pmc/articles/PMC10652513/ /pubmed/37974167 http://dx.doi.org/10.1186/s12920-023-01730-5 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Chang, Lixian
Zhang, Li
Zhao, Beibei
Cheng, Xuelian
Wan, Yang
Zhang, Ranran
Yuan, Weiping
Gao, Xingjie
Zhu, Xiaofan
Mutation spectrum, expression profiling, and prognosis evaluation of Fanconi anemia signaling pathway genes for 4259 patients with myelodysplastic syndromes or acute myeloid leukemia
title Mutation spectrum, expression profiling, and prognosis evaluation of Fanconi anemia signaling pathway genes for 4259 patients with myelodysplastic syndromes or acute myeloid leukemia
title_full Mutation spectrum, expression profiling, and prognosis evaluation of Fanconi anemia signaling pathway genes for 4259 patients with myelodysplastic syndromes or acute myeloid leukemia
title_fullStr Mutation spectrum, expression profiling, and prognosis evaluation of Fanconi anemia signaling pathway genes for 4259 patients with myelodysplastic syndromes or acute myeloid leukemia
title_full_unstemmed Mutation spectrum, expression profiling, and prognosis evaluation of Fanconi anemia signaling pathway genes for 4259 patients with myelodysplastic syndromes or acute myeloid leukemia
title_short Mutation spectrum, expression profiling, and prognosis evaluation of Fanconi anemia signaling pathway genes for 4259 patients with myelodysplastic syndromes or acute myeloid leukemia
title_sort mutation spectrum, expression profiling, and prognosis evaluation of fanconi anemia signaling pathway genes for 4259 patients with myelodysplastic syndromes or acute myeloid leukemia
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10652513/
https://www.ncbi.nlm.nih.gov/pubmed/37974167
http://dx.doi.org/10.1186/s12920-023-01730-5
work_keys_str_mv AT changlixian mutationspectrumexpressionprofilingandprognosisevaluationoffanconianemiasignalingpathwaygenesfor4259patientswithmyelodysplasticsyndromesoracutemyeloidleukemia
AT zhangli mutationspectrumexpressionprofilingandprognosisevaluationoffanconianemiasignalingpathwaygenesfor4259patientswithmyelodysplasticsyndromesoracutemyeloidleukemia
AT zhaobeibei mutationspectrumexpressionprofilingandprognosisevaluationoffanconianemiasignalingpathwaygenesfor4259patientswithmyelodysplasticsyndromesoracutemyeloidleukemia
AT chengxuelian mutationspectrumexpressionprofilingandprognosisevaluationoffanconianemiasignalingpathwaygenesfor4259patientswithmyelodysplasticsyndromesoracutemyeloidleukemia
AT wanyang mutationspectrumexpressionprofilingandprognosisevaluationoffanconianemiasignalingpathwaygenesfor4259patientswithmyelodysplasticsyndromesoracutemyeloidleukemia
AT zhangranran mutationspectrumexpressionprofilingandprognosisevaluationoffanconianemiasignalingpathwaygenesfor4259patientswithmyelodysplasticsyndromesoracutemyeloidleukemia
AT yuanweiping mutationspectrumexpressionprofilingandprognosisevaluationoffanconianemiasignalingpathwaygenesfor4259patientswithmyelodysplasticsyndromesoracutemyeloidleukemia
AT gaoxingjie mutationspectrumexpressionprofilingandprognosisevaluationoffanconianemiasignalingpathwaygenesfor4259patientswithmyelodysplasticsyndromesoracutemyeloidleukemia
AT zhuxiaofan mutationspectrumexpressionprofilingandprognosisevaluationoffanconianemiasignalingpathwaygenesfor4259patientswithmyelodysplasticsyndromesoracutemyeloidleukemia