Cargando…
Mutation spectrum, expression profiling, and prognosis evaluation of Fanconi anemia signaling pathway genes for 4259 patients with myelodysplastic syndromes or acute myeloid leukemia
BACKGROUND: Individuals diagnosed with Fanconi anemia (FA), an uncommon disorder characterized by chromosomal instability affecting the FA signaling pathway, exhibit heightened vulnerability to the onset of myelodysplastic syndromes (MDS) or acute myeloid leukemia (AML). METHODS: Herein, we employed...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10652513/ https://www.ncbi.nlm.nih.gov/pubmed/37974167 http://dx.doi.org/10.1186/s12920-023-01730-5 |
_version_ | 1785147700956626944 |
---|---|
author | Chang, Lixian Zhang, Li Zhao, Beibei Cheng, Xuelian Wan, Yang Zhang, Ranran Yuan, Weiping Gao, Xingjie Zhu, Xiaofan |
author_facet | Chang, Lixian Zhang, Li Zhao, Beibei Cheng, Xuelian Wan, Yang Zhang, Ranran Yuan, Weiping Gao, Xingjie Zhu, Xiaofan |
author_sort | Chang, Lixian |
collection | PubMed |
description | BACKGROUND: Individuals diagnosed with Fanconi anemia (FA), an uncommon disorder characterized by chromosomal instability affecting the FA signaling pathway, exhibit heightened vulnerability to the onset of myelodysplastic syndromes (MDS) or acute myeloid leukemia (AML). METHODS: Herein, we employed diverse bioinformatics and statistical analyses to investigate the potential associations between the expression/mutation patterns of FA pathway genes and MDS/AML. RESULTS: The study included 4295 samples, comprising 3235 AML and 1024 MDS from our and nine other online cohorts. We investigated the distinct proportion of race, age, French-American-British, and gender factors. Compared to the FA wild-type group, we observed a decrease in the expression of FNACD2, FANCI, and RAD51C in the FA mutation group. The FA mutation group exhibited a more favorable clinical overall survival prognosis. We developed a random forest classifier and a decision tree based on FA gene expression for cytogenetic risk assessment. Furthermore, we created an FA-related Nomogram to predict survival rates in AML patients. CONCLUSIONS: This investigation facilitates a deeper understanding of the functional links between FA and MDS/AML. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12920-023-01730-5. |
format | Online Article Text |
id | pubmed-10652513 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-106525132023-11-16 Mutation spectrum, expression profiling, and prognosis evaluation of Fanconi anemia signaling pathway genes for 4259 patients with myelodysplastic syndromes or acute myeloid leukemia Chang, Lixian Zhang, Li Zhao, Beibei Cheng, Xuelian Wan, Yang Zhang, Ranran Yuan, Weiping Gao, Xingjie Zhu, Xiaofan BMC Med Genomics Research BACKGROUND: Individuals diagnosed with Fanconi anemia (FA), an uncommon disorder characterized by chromosomal instability affecting the FA signaling pathway, exhibit heightened vulnerability to the onset of myelodysplastic syndromes (MDS) or acute myeloid leukemia (AML). METHODS: Herein, we employed diverse bioinformatics and statistical analyses to investigate the potential associations between the expression/mutation patterns of FA pathway genes and MDS/AML. RESULTS: The study included 4295 samples, comprising 3235 AML and 1024 MDS from our and nine other online cohorts. We investigated the distinct proportion of race, age, French-American-British, and gender factors. Compared to the FA wild-type group, we observed a decrease in the expression of FNACD2, FANCI, and RAD51C in the FA mutation group. The FA mutation group exhibited a more favorable clinical overall survival prognosis. We developed a random forest classifier and a decision tree based on FA gene expression for cytogenetic risk assessment. Furthermore, we created an FA-related Nomogram to predict survival rates in AML patients. CONCLUSIONS: This investigation facilitates a deeper understanding of the functional links between FA and MDS/AML. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12920-023-01730-5. BioMed Central 2023-11-16 /pmc/articles/PMC10652513/ /pubmed/37974167 http://dx.doi.org/10.1186/s12920-023-01730-5 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Chang, Lixian Zhang, Li Zhao, Beibei Cheng, Xuelian Wan, Yang Zhang, Ranran Yuan, Weiping Gao, Xingjie Zhu, Xiaofan Mutation spectrum, expression profiling, and prognosis evaluation of Fanconi anemia signaling pathway genes for 4259 patients with myelodysplastic syndromes or acute myeloid leukemia |
title | Mutation spectrum, expression profiling, and prognosis evaluation of Fanconi anemia signaling pathway genes for 4259 patients with myelodysplastic syndromes or acute myeloid leukemia |
title_full | Mutation spectrum, expression profiling, and prognosis evaluation of Fanconi anemia signaling pathway genes for 4259 patients with myelodysplastic syndromes or acute myeloid leukemia |
title_fullStr | Mutation spectrum, expression profiling, and prognosis evaluation of Fanconi anemia signaling pathway genes for 4259 patients with myelodysplastic syndromes or acute myeloid leukemia |
title_full_unstemmed | Mutation spectrum, expression profiling, and prognosis evaluation of Fanconi anemia signaling pathway genes for 4259 patients with myelodysplastic syndromes or acute myeloid leukemia |
title_short | Mutation spectrum, expression profiling, and prognosis evaluation of Fanconi anemia signaling pathway genes for 4259 patients with myelodysplastic syndromes or acute myeloid leukemia |
title_sort | mutation spectrum, expression profiling, and prognosis evaluation of fanconi anemia signaling pathway genes for 4259 patients with myelodysplastic syndromes or acute myeloid leukemia |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10652513/ https://www.ncbi.nlm.nih.gov/pubmed/37974167 http://dx.doi.org/10.1186/s12920-023-01730-5 |
work_keys_str_mv | AT changlixian mutationspectrumexpressionprofilingandprognosisevaluationoffanconianemiasignalingpathwaygenesfor4259patientswithmyelodysplasticsyndromesoracutemyeloidleukemia AT zhangli mutationspectrumexpressionprofilingandprognosisevaluationoffanconianemiasignalingpathwaygenesfor4259patientswithmyelodysplasticsyndromesoracutemyeloidleukemia AT zhaobeibei mutationspectrumexpressionprofilingandprognosisevaluationoffanconianemiasignalingpathwaygenesfor4259patientswithmyelodysplasticsyndromesoracutemyeloidleukemia AT chengxuelian mutationspectrumexpressionprofilingandprognosisevaluationoffanconianemiasignalingpathwaygenesfor4259patientswithmyelodysplasticsyndromesoracutemyeloidleukemia AT wanyang mutationspectrumexpressionprofilingandprognosisevaluationoffanconianemiasignalingpathwaygenesfor4259patientswithmyelodysplasticsyndromesoracutemyeloidleukemia AT zhangranran mutationspectrumexpressionprofilingandprognosisevaluationoffanconianemiasignalingpathwaygenesfor4259patientswithmyelodysplasticsyndromesoracutemyeloidleukemia AT yuanweiping mutationspectrumexpressionprofilingandprognosisevaluationoffanconianemiasignalingpathwaygenesfor4259patientswithmyelodysplasticsyndromesoracutemyeloidleukemia AT gaoxingjie mutationspectrumexpressionprofilingandprognosisevaluationoffanconianemiasignalingpathwaygenesfor4259patientswithmyelodysplasticsyndromesoracutemyeloidleukemia AT zhuxiaofan mutationspectrumexpressionprofilingandprognosisevaluationoffanconianemiasignalingpathwaygenesfor4259patientswithmyelodysplasticsyndromesoracutemyeloidleukemia |