Cargando…

Novel APC mutations in Czech and Slovak FAP families: clinical and genetic aspects

BACKGROUND: Germline mutations in the adenomatous polyposis gene (APC) result in familial adenomatous polyposis (FAP). FAP is an autosomal dominantly inherited disorder predisposing to colorectal cancer. Typical FAP is characterized by hundreds to thousands of colorectal adenomatous polyps and by se...

Descripción completa

Detalles Bibliográficos
Autores principales: Stekrova, Jitka, Sulova, Martina, Kebrdlova, Vera, Zidkova, Katerina, Kotlas, Jaroslav, Ilencikova, Denisa, Vesela, Kamila, Kohoutova, Milada
Formato: Texto
Lenguaje:English
Publicado: BioMed Central 2007
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC1853078/
https://www.ncbi.nlm.nih.gov/pubmed/17411426
http://dx.doi.org/10.1186/1471-2350-8-16
_version_ 1782133100666421248
author Stekrova, Jitka
Sulova, Martina
Kebrdlova, Vera
Zidkova, Katerina
Kotlas, Jaroslav
Ilencikova, Denisa
Vesela, Kamila
Kohoutova, Milada
author_facet Stekrova, Jitka
Sulova, Martina
Kebrdlova, Vera
Zidkova, Katerina
Kotlas, Jaroslav
Ilencikova, Denisa
Vesela, Kamila
Kohoutova, Milada
author_sort Stekrova, Jitka
collection PubMed
description BACKGROUND: Germline mutations in the adenomatous polyposis gene (APC) result in familial adenomatous polyposis (FAP). FAP is an autosomal dominantly inherited disorder predisposing to colorectal cancer. Typical FAP is characterized by hundreds to thousands of colorectal adenomatous polyps and by several extracolonic manifestations. An attenuated form of polyposis (AFAP) is characterized by less than 100 adenomas and later onset of the disease. METHODS: Here, we analyzed the APC gene for germline mutations in 59 Czech and 15 Slovak FAP patients. In addition, 50 apparently APC mutation negative Czech probands and 3 probands of Slovak origin were screened for large deletions encompassing the APC gene. Mutation screening was performed using denaturing gradient gel electrophoresis and/or protein truncation test. DNA fragments showing an aberrant electrophoretic banding pattern were sequenced. Screening for large deletions was performed by multiplex ligation dependent probe amplification. The extent of deletions was analyzed using following microsatellite markers: D5S299, D5S82, D5S134 and D5S346. RESULTS: In the set of Czech and Slovak patients, we identified 46 germline mutations among 74 unrelated probands. Total mutation capture is 62,2% including large deletions. Thirty seven mutations were detected in 49 patients presenting a classical FAP phenotype (75,5%) and 9 mutations in 25 patients with attenuated FAP (36%). We report 20 novel germline APC mutations and 3 large deletions (6%) encompassing the whole-gene deletions and/or exon 14 deletion. In the patients with novel mutations, correlations of the mutation localization are discussed in context of the classical and/or attenuated phenotype of the disease. CONCLUSION: The results of the molecular genetic testing are used both in the establishment of the predictive diagnosis and in the clinical management of patients. In some cases this study has also shown the difficulty to classify clinically between the classical and the attenuated form of FAP according to the established criteria. Interfamilial and/or intrafamilial phenotype variability was also confirmed in some cases which did not fit well with predicted genotype-phenotype correlation. All these findings have to be taken into consideration both in the genetic counselling and in the patient care.
format Text
id pubmed-1853078
institution National Center for Biotechnology Information
language English
publishDate 2007
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-18530782007-04-20 Novel APC mutations in Czech and Slovak FAP families: clinical and genetic aspects Stekrova, Jitka Sulova, Martina Kebrdlova, Vera Zidkova, Katerina Kotlas, Jaroslav Ilencikova, Denisa Vesela, Kamila Kohoutova, Milada BMC Med Genet Research Article BACKGROUND: Germline mutations in the adenomatous polyposis gene (APC) result in familial adenomatous polyposis (FAP). FAP is an autosomal dominantly inherited disorder predisposing to colorectal cancer. Typical FAP is characterized by hundreds to thousands of colorectal adenomatous polyps and by several extracolonic manifestations. An attenuated form of polyposis (AFAP) is characterized by less than 100 adenomas and later onset of the disease. METHODS: Here, we analyzed the APC gene for germline mutations in 59 Czech and 15 Slovak FAP patients. In addition, 50 apparently APC mutation negative Czech probands and 3 probands of Slovak origin were screened for large deletions encompassing the APC gene. Mutation screening was performed using denaturing gradient gel electrophoresis and/or protein truncation test. DNA fragments showing an aberrant electrophoretic banding pattern were sequenced. Screening for large deletions was performed by multiplex ligation dependent probe amplification. The extent of deletions was analyzed using following microsatellite markers: D5S299, D5S82, D5S134 and D5S346. RESULTS: In the set of Czech and Slovak patients, we identified 46 germline mutations among 74 unrelated probands. Total mutation capture is 62,2% including large deletions. Thirty seven mutations were detected in 49 patients presenting a classical FAP phenotype (75,5%) and 9 mutations in 25 patients with attenuated FAP (36%). We report 20 novel germline APC mutations and 3 large deletions (6%) encompassing the whole-gene deletions and/or exon 14 deletion. In the patients with novel mutations, correlations of the mutation localization are discussed in context of the classical and/or attenuated phenotype of the disease. CONCLUSION: The results of the molecular genetic testing are used both in the establishment of the predictive diagnosis and in the clinical management of patients. In some cases this study has also shown the difficulty to classify clinically between the classical and the attenuated form of FAP according to the established criteria. Interfamilial and/or intrafamilial phenotype variability was also confirmed in some cases which did not fit well with predicted genotype-phenotype correlation. All these findings have to be taken into consideration both in the genetic counselling and in the patient care. BioMed Central 2007-04-05 /pmc/articles/PMC1853078/ /pubmed/17411426 http://dx.doi.org/10.1186/1471-2350-8-16 Text en Copyright © 2007 Stekrova et al; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License ( (http://creativecommons.org/licenses/by/2.0) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Article
Stekrova, Jitka
Sulova, Martina
Kebrdlova, Vera
Zidkova, Katerina
Kotlas, Jaroslav
Ilencikova, Denisa
Vesela, Kamila
Kohoutova, Milada
Novel APC mutations in Czech and Slovak FAP families: clinical and genetic aspects
title Novel APC mutations in Czech and Slovak FAP families: clinical and genetic aspects
title_full Novel APC mutations in Czech and Slovak FAP families: clinical and genetic aspects
title_fullStr Novel APC mutations in Czech and Slovak FAP families: clinical and genetic aspects
title_full_unstemmed Novel APC mutations in Czech and Slovak FAP families: clinical and genetic aspects
title_short Novel APC mutations in Czech and Slovak FAP families: clinical and genetic aspects
title_sort novel apc mutations in czech and slovak fap families: clinical and genetic aspects
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC1853078/
https://www.ncbi.nlm.nih.gov/pubmed/17411426
http://dx.doi.org/10.1186/1471-2350-8-16
work_keys_str_mv AT stekrovajitka novelapcmutationsinczechandslovakfapfamiliesclinicalandgeneticaspects
AT sulovamartina novelapcmutationsinczechandslovakfapfamiliesclinicalandgeneticaspects
AT kebrdlovavera novelapcmutationsinczechandslovakfapfamiliesclinicalandgeneticaspects
AT zidkovakaterina novelapcmutationsinczechandslovakfapfamiliesclinicalandgeneticaspects
AT kotlasjaroslav novelapcmutationsinczechandslovakfapfamiliesclinicalandgeneticaspects
AT ilencikovadenisa novelapcmutationsinczechandslovakfapfamiliesclinicalandgeneticaspects
AT veselakamila novelapcmutationsinczechandslovakfapfamiliesclinicalandgeneticaspects
AT kohoutovamilada novelapcmutationsinczechandslovakfapfamiliesclinicalandgeneticaspects