Cargando…
Localized Populations of CD8(low/−) MHC Class I Tetramer(+) SIV-Specific T Cells in Lymphoid Follicles and Genital Epithelium
CD8 T cells play an important role in controlling viral infections. We investigated the in situ localization of simian immunodeficiency virus (SIV)-specific T cells in lymph and genital tissues from SIV-infected macaques using MHC-class I tetramers. The majority of tetramer-binding cells localized i...
Autores principales: | , , , , , , |
---|---|
Formato: | Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2009
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2607009/ https://www.ncbi.nlm.nih.gov/pubmed/19122815 http://dx.doi.org/10.1371/journal.pone.0004131 |
_version_ | 1782163021715472384 |
---|---|
author | Hong, Jung Joo Reynolds, Matthew R. Mattila, Teresa L. Hage, Aaron Watkins, David I. Miller, Christopher J. Skinner, Pamela J. |
author_facet | Hong, Jung Joo Reynolds, Matthew R. Mattila, Teresa L. Hage, Aaron Watkins, David I. Miller, Christopher J. Skinner, Pamela J. |
author_sort | Hong, Jung Joo |
collection | PubMed |
description | CD8 T cells play an important role in controlling viral infections. We investigated the in situ localization of simian immunodeficiency virus (SIV)-specific T cells in lymph and genital tissues from SIV-infected macaques using MHC-class I tetramers. The majority of tetramer-binding cells localized in T cell zones and were CD8(+). Curiously, small subpopulations of tetramer-binding cells that had little to no surface CD8 were detected in situ both early and late post-infection, and in both vaginally and rectally inoculated macaques. These tetramer(+)CD8(low/−) cells were more often localized in apparent B cell follicles relative to T cell zones and more often found near or within the genital epithelium than the submucosa. Cells analyzed by flow cytometry showed similar populations of cells. Further immunohistological characterization revealed small populations of tetramer(+)CD20(−) cells inside B cell follicles and that tetramer(+) cells did not stain with γδ-TCR nor CD4 antibodies. Negative control tetramer staining indicated that tetramer(+)CD8(low/−) cells were not likely NK cells non-specifically binding to MHC tetramers. These findings have important implications for SIV-specific and other antigen-specific T cell function in these specific tissue locations, and suggest a model in which antigen-specific CD8+ T cells down modulate CD8 upon entering B cell follicles or the epithelial layer of tissues, or alternatively a model in which only antigen-specific CD8 T cells that down-modulate CD8 can enter B cell follicles or the epithelium. |
format | Text |
id | pubmed-2607009 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2009 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-26070092009-01-05 Localized Populations of CD8(low/−) MHC Class I Tetramer(+) SIV-Specific T Cells in Lymphoid Follicles and Genital Epithelium Hong, Jung Joo Reynolds, Matthew R. Mattila, Teresa L. Hage, Aaron Watkins, David I. Miller, Christopher J. Skinner, Pamela J. PLoS One Research Article CD8 T cells play an important role in controlling viral infections. We investigated the in situ localization of simian immunodeficiency virus (SIV)-specific T cells in lymph and genital tissues from SIV-infected macaques using MHC-class I tetramers. The majority of tetramer-binding cells localized in T cell zones and were CD8(+). Curiously, small subpopulations of tetramer-binding cells that had little to no surface CD8 were detected in situ both early and late post-infection, and in both vaginally and rectally inoculated macaques. These tetramer(+)CD8(low/−) cells were more often localized in apparent B cell follicles relative to T cell zones and more often found near or within the genital epithelium than the submucosa. Cells analyzed by flow cytometry showed similar populations of cells. Further immunohistological characterization revealed small populations of tetramer(+)CD20(−) cells inside B cell follicles and that tetramer(+) cells did not stain with γδ-TCR nor CD4 antibodies. Negative control tetramer staining indicated that tetramer(+)CD8(low/−) cells were not likely NK cells non-specifically binding to MHC tetramers. These findings have important implications for SIV-specific and other antigen-specific T cell function in these specific tissue locations, and suggest a model in which antigen-specific CD8+ T cells down modulate CD8 upon entering B cell follicles or the epithelial layer of tissues, or alternatively a model in which only antigen-specific CD8 T cells that down-modulate CD8 can enter B cell follicles or the epithelium. Public Library of Science 2009-01-05 /pmc/articles/PMC2607009/ /pubmed/19122815 http://dx.doi.org/10.1371/journal.pone.0004131 Text en Hong et al. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Hong, Jung Joo Reynolds, Matthew R. Mattila, Teresa L. Hage, Aaron Watkins, David I. Miller, Christopher J. Skinner, Pamela J. Localized Populations of CD8(low/−) MHC Class I Tetramer(+) SIV-Specific T Cells in Lymphoid Follicles and Genital Epithelium |
title | Localized Populations of CD8(low/−) MHC Class I Tetramer(+) SIV-Specific T Cells in Lymphoid Follicles and Genital Epithelium |
title_full | Localized Populations of CD8(low/−) MHC Class I Tetramer(+) SIV-Specific T Cells in Lymphoid Follicles and Genital Epithelium |
title_fullStr | Localized Populations of CD8(low/−) MHC Class I Tetramer(+) SIV-Specific T Cells in Lymphoid Follicles and Genital Epithelium |
title_full_unstemmed | Localized Populations of CD8(low/−) MHC Class I Tetramer(+) SIV-Specific T Cells in Lymphoid Follicles and Genital Epithelium |
title_short | Localized Populations of CD8(low/−) MHC Class I Tetramer(+) SIV-Specific T Cells in Lymphoid Follicles and Genital Epithelium |
title_sort | localized populations of cd8(low/−) mhc class i tetramer(+) siv-specific t cells in lymphoid follicles and genital epithelium |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2607009/ https://www.ncbi.nlm.nih.gov/pubmed/19122815 http://dx.doi.org/10.1371/journal.pone.0004131 |
work_keys_str_mv | AT hongjungjoo localizedpopulationsofcd8lowmhcclassitetramersivspecifictcellsinlymphoidfolliclesandgenitalepithelium AT reynoldsmatthewr localizedpopulationsofcd8lowmhcclassitetramersivspecifictcellsinlymphoidfolliclesandgenitalepithelium AT mattilateresal localizedpopulationsofcd8lowmhcclassitetramersivspecifictcellsinlymphoidfolliclesandgenitalepithelium AT hageaaron localizedpopulationsofcd8lowmhcclassitetramersivspecifictcellsinlymphoidfolliclesandgenitalepithelium AT watkinsdavidi localizedpopulationsofcd8lowmhcclassitetramersivspecifictcellsinlymphoidfolliclesandgenitalepithelium AT millerchristopherj localizedpopulationsofcd8lowmhcclassitetramersivspecifictcellsinlymphoidfolliclesandgenitalepithelium AT skinnerpamelaj localizedpopulationsofcd8lowmhcclassitetramersivspecifictcellsinlymphoidfolliclesandgenitalepithelium |