Cargando…

On the Conservation of the Slow Conformational Dynamics within the Amino Acid Kinase Family: NAGK the Paradigm

N-Acetyl-L-Glutamate Kinase (NAGK) is the structural paradigm for examining the catalytic mechanisms and dynamics of amino acid kinase family members. Given that the slow conformational dynamics of the NAGK (at the microseconds time scale or slower) may be rate-limiting, it is of importance to asses...

Descripción completa

Detalles Bibliográficos
Autores principales: Marcos, Enrique, Crehuet, Ramon, Bahar, Ivet
Formato: Texto
Lenguaje:English
Publicado: Public Library of Science 2010
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2851564/
https://www.ncbi.nlm.nih.gov/pubmed/20386738
http://dx.doi.org/10.1371/journal.pcbi.1000738
_version_ 1782179872147243008
author Marcos, Enrique
Crehuet, Ramon
Bahar, Ivet
author_facet Marcos, Enrique
Crehuet, Ramon
Bahar, Ivet
author_sort Marcos, Enrique
collection PubMed
description N-Acetyl-L-Glutamate Kinase (NAGK) is the structural paradigm for examining the catalytic mechanisms and dynamics of amino acid kinase family members. Given that the slow conformational dynamics of the NAGK (at the microseconds time scale or slower) may be rate-limiting, it is of importance to assess the mechanisms of the most cooperative modes of motion intrinsically accessible to this enzyme. Here, we present the results from normal mode analysis using an elastic network model representation, which shows that the conformational mechanisms for substrate binding by NAGK strongly correlate with the intrinsic dynamics of the enzyme in the unbound form. We further analyzed the potential mechanisms of allosteric signalling within NAGK using a Markov model for network communication. Comparative analysis of the dynamics of family members strongly suggests that the low-frequency modes of motion and the associated intramolecular couplings that establish signal transduction are highly conserved among family members, in support of the paradigm sequence→structure→dynamics→function.
format Text
id pubmed-2851564
institution National Center for Biotechnology Information
language English
publishDate 2010
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-28515642010-04-12 On the Conservation of the Slow Conformational Dynamics within the Amino Acid Kinase Family: NAGK the Paradigm Marcos, Enrique Crehuet, Ramon Bahar, Ivet PLoS Comput Biol Research Article N-Acetyl-L-Glutamate Kinase (NAGK) is the structural paradigm for examining the catalytic mechanisms and dynamics of amino acid kinase family members. Given that the slow conformational dynamics of the NAGK (at the microseconds time scale or slower) may be rate-limiting, it is of importance to assess the mechanisms of the most cooperative modes of motion intrinsically accessible to this enzyme. Here, we present the results from normal mode analysis using an elastic network model representation, which shows that the conformational mechanisms for substrate binding by NAGK strongly correlate with the intrinsic dynamics of the enzyme in the unbound form. We further analyzed the potential mechanisms of allosteric signalling within NAGK using a Markov model for network communication. Comparative analysis of the dynamics of family members strongly suggests that the low-frequency modes of motion and the associated intramolecular couplings that establish signal transduction are highly conserved among family members, in support of the paradigm sequence→structure→dynamics→function. Public Library of Science 2010-04-08 /pmc/articles/PMC2851564/ /pubmed/20386738 http://dx.doi.org/10.1371/journal.pcbi.1000738 Text en Marcos et al. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited.
spellingShingle Research Article
Marcos, Enrique
Crehuet, Ramon
Bahar, Ivet
On the Conservation of the Slow Conformational Dynamics within the Amino Acid Kinase Family: NAGK the Paradigm
title On the Conservation of the Slow Conformational Dynamics within the Amino Acid Kinase Family: NAGK the Paradigm
title_full On the Conservation of the Slow Conformational Dynamics within the Amino Acid Kinase Family: NAGK the Paradigm
title_fullStr On the Conservation of the Slow Conformational Dynamics within the Amino Acid Kinase Family: NAGK the Paradigm
title_full_unstemmed On the Conservation of the Slow Conformational Dynamics within the Amino Acid Kinase Family: NAGK the Paradigm
title_short On the Conservation of the Slow Conformational Dynamics within the Amino Acid Kinase Family: NAGK the Paradigm
title_sort on the conservation of the slow conformational dynamics within the amino acid kinase family: nagk the paradigm
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2851564/
https://www.ncbi.nlm.nih.gov/pubmed/20386738
http://dx.doi.org/10.1371/journal.pcbi.1000738
work_keys_str_mv AT marcosenrique ontheconservationoftheslowconformationaldynamicswithintheaminoacidkinasefamilynagktheparadigm
AT crehuetramon ontheconservationoftheslowconformationaldynamicswithintheaminoacidkinasefamilynagktheparadigm
AT baharivet ontheconservationoftheslowconformationaldynamicswithintheaminoacidkinasefamilynagktheparadigm