Cargando…
Disturbance of the OPG/RANK/RANKL pathway and systemic inflammation in COPD patients with emphysema and osteoporosis
BACKGROUND: Osteoporosis is one of the systemic features of COPD. A correlation between the emphysema phenotype of COPD and reduced bone mineral density (BMD) is suggested by some studies, however, the mechanisms underlying this relationship are unclear. Experimental studies indicate that IL-1β, IL-...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2011
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3260206/ https://www.ncbi.nlm.nih.gov/pubmed/22176920 http://dx.doi.org/10.1186/1465-9921-12-157 |
_version_ | 1782221458602196992 |
---|---|
author | Bai, Peng Sun, Yongchang Jin, Jianmin Hou, Jia Li, Ran Zhang, Qing Wang, Yang |
author_facet | Bai, Peng Sun, Yongchang Jin, Jianmin Hou, Jia Li, Ran Zhang, Qing Wang, Yang |
author_sort | Bai, Peng |
collection | PubMed |
description | BACKGROUND: Osteoporosis is one of the systemic features of COPD. A correlation between the emphysema phenotype of COPD and reduced bone mineral density (BMD) is suggested by some studies, however, the mechanisms underlying this relationship are unclear. Experimental studies indicate that IL-1β, IL-6 and TNF-α may play important roles in the etiology of both osteoporosis and emphysema. The OPG/RANK/RANKL system is an important regulator of bone metabolism, and participates in the development of post-menopausal osteoporosis. Whether the OPG/RANK/RANKL pathway is involved in the pathogenesis of osteoporosis in COPD has not been studied. METHODS: Eighty male patients (current or former smokers) completed a chest CT scan, pulmonary function test, dual x-ray absorptiometry measurements and questionnaires. Among these subjects, thirty patients with normal BMD and thirty patients with low BMD were selected randomly for measurement of IL-1β, IL-6, TNF-α (flow cytometry) and OPG/RANK/RANKL (ELISA). Twenty age-matched healthy volunteers were recruited as controls. RESULTS: Among these eighty patients, thirty-six had normal BMD and forty-four had low BMD. Age, BMI and CAT score showed significant differences between these two COPD groups (p < 0.05). The low-attenuation area (LAA%) in the lungs of COPD patients was negatively correlated with lumbar vertebral BMD (r = 0.741; p < 0.0001). Forward logistic regression analysis showed that only LAA% (p = 0.005) and BMI (p = 0.009) were selected as explanatory variables. The level of IL-1β was significantly higher in the COPD patients as compared to the normal controls (p < 0.05), but the difference between the two COPD groups did not reach significance. The levels of IL-6 and TNF-α among the three groups were significantly different (p < 0.05). The level of RANKL and the RANKL/OPG ratio were significantly higher in COPD patients with low BMD compared to those with normal BMD and the normal controls (p < 0.05), and correlated negatively with lumbar vertebral BMD, but positively with LAA%. CONCLUSIONS: Radiographic emphysema is correlated with low BMD in current and former smokers with COPD. IL-1β, IL-6, TNF-α, and the osteoporosis-related protein system OPG/RANK/RANKL may have some synergetic effects on emphysema and bone loss in COPD. |
format | Online Article Text |
id | pubmed-3260206 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2011 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-32602062012-01-18 Disturbance of the OPG/RANK/RANKL pathway and systemic inflammation in COPD patients with emphysema and osteoporosis Bai, Peng Sun, Yongchang Jin, Jianmin Hou, Jia Li, Ran Zhang, Qing Wang, Yang Respir Res Research BACKGROUND: Osteoporosis is one of the systemic features of COPD. A correlation between the emphysema phenotype of COPD and reduced bone mineral density (BMD) is suggested by some studies, however, the mechanisms underlying this relationship are unclear. Experimental studies indicate that IL-1β, IL-6 and TNF-α may play important roles in the etiology of both osteoporosis and emphysema. The OPG/RANK/RANKL system is an important regulator of bone metabolism, and participates in the development of post-menopausal osteoporosis. Whether the OPG/RANK/RANKL pathway is involved in the pathogenesis of osteoporosis in COPD has not been studied. METHODS: Eighty male patients (current or former smokers) completed a chest CT scan, pulmonary function test, dual x-ray absorptiometry measurements and questionnaires. Among these subjects, thirty patients with normal BMD and thirty patients with low BMD were selected randomly for measurement of IL-1β, IL-6, TNF-α (flow cytometry) and OPG/RANK/RANKL (ELISA). Twenty age-matched healthy volunteers were recruited as controls. RESULTS: Among these eighty patients, thirty-six had normal BMD and forty-four had low BMD. Age, BMI and CAT score showed significant differences between these two COPD groups (p < 0.05). The low-attenuation area (LAA%) in the lungs of COPD patients was negatively correlated with lumbar vertebral BMD (r = 0.741; p < 0.0001). Forward logistic regression analysis showed that only LAA% (p = 0.005) and BMI (p = 0.009) were selected as explanatory variables. The level of IL-1β was significantly higher in the COPD patients as compared to the normal controls (p < 0.05), but the difference between the two COPD groups did not reach significance. The levels of IL-6 and TNF-α among the three groups were significantly different (p < 0.05). The level of RANKL and the RANKL/OPG ratio were significantly higher in COPD patients with low BMD compared to those with normal BMD and the normal controls (p < 0.05), and correlated negatively with lumbar vertebral BMD, but positively with LAA%. CONCLUSIONS: Radiographic emphysema is correlated with low BMD in current and former smokers with COPD. IL-1β, IL-6, TNF-α, and the osteoporosis-related protein system OPG/RANK/RANKL may have some synergetic effects on emphysema and bone loss in COPD. BioMed Central 2011 2011-12-16 /pmc/articles/PMC3260206/ /pubmed/22176920 http://dx.doi.org/10.1186/1465-9921-12-157 Text en Copyright ©2011 Bai et al; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Bai, Peng Sun, Yongchang Jin, Jianmin Hou, Jia Li, Ran Zhang, Qing Wang, Yang Disturbance of the OPG/RANK/RANKL pathway and systemic inflammation in COPD patients with emphysema and osteoporosis |
title | Disturbance of the OPG/RANK/RANKL pathway and systemic inflammation in COPD patients with emphysema and osteoporosis |
title_full | Disturbance of the OPG/RANK/RANKL pathway and systemic inflammation in COPD patients with emphysema and osteoporosis |
title_fullStr | Disturbance of the OPG/RANK/RANKL pathway and systemic inflammation in COPD patients with emphysema and osteoporosis |
title_full_unstemmed | Disturbance of the OPG/RANK/RANKL pathway and systemic inflammation in COPD patients with emphysema and osteoporosis |
title_short | Disturbance of the OPG/RANK/RANKL pathway and systemic inflammation in COPD patients with emphysema and osteoporosis |
title_sort | disturbance of the opg/rank/rankl pathway and systemic inflammation in copd patients with emphysema and osteoporosis |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3260206/ https://www.ncbi.nlm.nih.gov/pubmed/22176920 http://dx.doi.org/10.1186/1465-9921-12-157 |
work_keys_str_mv | AT baipeng disturbanceoftheopgrankranklpathwayandsystemicinflammationincopdpatientswithemphysemaandosteoporosis AT sunyongchang disturbanceoftheopgrankranklpathwayandsystemicinflammationincopdpatientswithemphysemaandosteoporosis AT jinjianmin disturbanceoftheopgrankranklpathwayandsystemicinflammationincopdpatientswithemphysemaandosteoporosis AT houjia disturbanceoftheopgrankranklpathwayandsystemicinflammationincopdpatientswithemphysemaandosteoporosis AT liran disturbanceoftheopgrankranklpathwayandsystemicinflammationincopdpatientswithemphysemaandosteoporosis AT zhangqing disturbanceoftheopgrankranklpathwayandsystemicinflammationincopdpatientswithemphysemaandosteoporosis AT wangyang disturbanceoftheopgrankranklpathwayandsystemicinflammationincopdpatientswithemphysemaandosteoporosis |