Cargando…

The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells

Thiazolidinediones (TZDs) dramatically reduce the growth of human prostate cancer cells in vitro and in vivo. To determine whether the antitumor effects of TZDs were due in part to changes in the MEK/Erk signaling pathway, we examined the regulation of Erk phosphorylation by the TZD troglitazone wit...

Descripción completa

Detalles Bibliográficos
Autores principales: Bolden, Adrienne, Bernard, Lynikka, Jones, Danielle, Akinyeke, Tunde, Stewart, LaMonica V.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Hindawi Publishing Corporation 2012
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3289875/
https://www.ncbi.nlm.nih.gov/pubmed/22448169
http://dx.doi.org/10.1155/2012/929052
_version_ 1782224912280190976
author Bolden, Adrienne
Bernard, Lynikka
Jones, Danielle
Akinyeke, Tunde
Stewart, LaMonica V.
author_facet Bolden, Adrienne
Bernard, Lynikka
Jones, Danielle
Akinyeke, Tunde
Stewart, LaMonica V.
author_sort Bolden, Adrienne
collection PubMed
description Thiazolidinediones (TZDs) dramatically reduce the growth of human prostate cancer cells in vitro and in vivo. To determine whether the antitumor effects of TZDs were due in part to changes in the MEK/Erk signaling pathway, we examined the regulation of Erk phosphorylation by the TZD troglitazone within the PC-3 and C4-2 human prostate cancer cell lines. Western blot analysis revealed troglitazone-induced phosphorylation of Erk in both PC-3 and C4-2 cells. Troglitazone-induced increases in Erk phosphorylation were suppressed by the MEK inhibitor U0126 but not by the PPARγ antagonist GW9662. Pretreatment with U0126 did not alter the ability of troglitazone to regulate expression of two proteins that control cell cycle, p21, and c-Myc. Troglitazone was also still effective at reducing PC-3 proliferation in the presence of U0126. Therefore, our data suggest that troglitazone-induced Erk phosphorylation does not significantly contribute to the antiproliferative effect of troglitazone.
format Online
Article
Text
id pubmed-3289875
institution National Center for Biotechnology Information
language English
publishDate 2012
publisher Hindawi Publishing Corporation
record_format MEDLINE/PubMed
spelling pubmed-32898752012-03-23 The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells Bolden, Adrienne Bernard, Lynikka Jones, Danielle Akinyeke, Tunde Stewart, LaMonica V. PPAR Res Research Article Thiazolidinediones (TZDs) dramatically reduce the growth of human prostate cancer cells in vitro and in vivo. To determine whether the antitumor effects of TZDs were due in part to changes in the MEK/Erk signaling pathway, we examined the regulation of Erk phosphorylation by the TZD troglitazone within the PC-3 and C4-2 human prostate cancer cell lines. Western blot analysis revealed troglitazone-induced phosphorylation of Erk in both PC-3 and C4-2 cells. Troglitazone-induced increases in Erk phosphorylation were suppressed by the MEK inhibitor U0126 but not by the PPARγ antagonist GW9662. Pretreatment with U0126 did not alter the ability of troglitazone to regulate expression of two proteins that control cell cycle, p21, and c-Myc. Troglitazone was also still effective at reducing PC-3 proliferation in the presence of U0126. Therefore, our data suggest that troglitazone-induced Erk phosphorylation does not significantly contribute to the antiproliferative effect of troglitazone. Hindawi Publishing Corporation 2012 2012-02-20 /pmc/articles/PMC3289875/ /pubmed/22448169 http://dx.doi.org/10.1155/2012/929052 Text en Copyright © 2012 Adrienne Bolden et al. https://creativecommons.org/licenses/by/3.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Article
Bolden, Adrienne
Bernard, Lynikka
Jones, Danielle
Akinyeke, Tunde
Stewart, LaMonica V.
The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells
title The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells
title_full The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells
title_fullStr The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells
title_full_unstemmed The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells
title_short The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells
title_sort ppar gamma agonist troglitazone regulates erk 1/2 phosphorylation via a pparγ-independent, mek-dependent pathway in human prostate cancer cells
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3289875/
https://www.ncbi.nlm.nih.gov/pubmed/22448169
http://dx.doi.org/10.1155/2012/929052
work_keys_str_mv AT boldenadrienne theppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells
AT bernardlynikka theppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells
AT jonesdanielle theppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells
AT akinyeketunde theppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells
AT stewartlamonicav theppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells
AT boldenadrienne ppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells
AT bernardlynikka ppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells
AT jonesdanielle ppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells
AT akinyeketunde ppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells
AT stewartlamonicav ppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells