Cargando…
The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells
Thiazolidinediones (TZDs) dramatically reduce the growth of human prostate cancer cells in vitro and in vivo. To determine whether the antitumor effects of TZDs were due in part to changes in the MEK/Erk signaling pathway, we examined the regulation of Erk phosphorylation by the TZD troglitazone wit...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi Publishing Corporation
2012
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3289875/ https://www.ncbi.nlm.nih.gov/pubmed/22448169 http://dx.doi.org/10.1155/2012/929052 |
_version_ | 1782224912280190976 |
---|---|
author | Bolden, Adrienne Bernard, Lynikka Jones, Danielle Akinyeke, Tunde Stewart, LaMonica V. |
author_facet | Bolden, Adrienne Bernard, Lynikka Jones, Danielle Akinyeke, Tunde Stewart, LaMonica V. |
author_sort | Bolden, Adrienne |
collection | PubMed |
description | Thiazolidinediones (TZDs) dramatically reduce the growth of human prostate cancer cells in vitro and in vivo. To determine whether the antitumor effects of TZDs were due in part to changes in the MEK/Erk signaling pathway, we examined the regulation of Erk phosphorylation by the TZD troglitazone within the PC-3 and C4-2 human prostate cancer cell lines. Western blot analysis revealed troglitazone-induced phosphorylation of Erk in both PC-3 and C4-2 cells. Troglitazone-induced increases in Erk phosphorylation were suppressed by the MEK inhibitor U0126 but not by the PPARγ antagonist GW9662. Pretreatment with U0126 did not alter the ability of troglitazone to regulate expression of two proteins that control cell cycle, p21, and c-Myc. Troglitazone was also still effective at reducing PC-3 proliferation in the presence of U0126. Therefore, our data suggest that troglitazone-induced Erk phosphorylation does not significantly contribute to the antiproliferative effect of troglitazone. |
format | Online Article Text |
id | pubmed-3289875 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2012 |
publisher | Hindawi Publishing Corporation |
record_format | MEDLINE/PubMed |
spelling | pubmed-32898752012-03-23 The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells Bolden, Adrienne Bernard, Lynikka Jones, Danielle Akinyeke, Tunde Stewart, LaMonica V. PPAR Res Research Article Thiazolidinediones (TZDs) dramatically reduce the growth of human prostate cancer cells in vitro and in vivo. To determine whether the antitumor effects of TZDs were due in part to changes in the MEK/Erk signaling pathway, we examined the regulation of Erk phosphorylation by the TZD troglitazone within the PC-3 and C4-2 human prostate cancer cell lines. Western blot analysis revealed troglitazone-induced phosphorylation of Erk in both PC-3 and C4-2 cells. Troglitazone-induced increases in Erk phosphorylation were suppressed by the MEK inhibitor U0126 but not by the PPARγ antagonist GW9662. Pretreatment with U0126 did not alter the ability of troglitazone to regulate expression of two proteins that control cell cycle, p21, and c-Myc. Troglitazone was also still effective at reducing PC-3 proliferation in the presence of U0126. Therefore, our data suggest that troglitazone-induced Erk phosphorylation does not significantly contribute to the antiproliferative effect of troglitazone. Hindawi Publishing Corporation 2012 2012-02-20 /pmc/articles/PMC3289875/ /pubmed/22448169 http://dx.doi.org/10.1155/2012/929052 Text en Copyright © 2012 Adrienne Bolden et al. https://creativecommons.org/licenses/by/3.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Bolden, Adrienne Bernard, Lynikka Jones, Danielle Akinyeke, Tunde Stewart, LaMonica V. The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells |
title | The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells |
title_full | The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells |
title_fullStr | The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells |
title_full_unstemmed | The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells |
title_short | The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells |
title_sort | ppar gamma agonist troglitazone regulates erk 1/2 phosphorylation via a pparγ-independent, mek-dependent pathway in human prostate cancer cells |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3289875/ https://www.ncbi.nlm.nih.gov/pubmed/22448169 http://dx.doi.org/10.1155/2012/929052 |
work_keys_str_mv | AT boldenadrienne theppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells AT bernardlynikka theppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells AT jonesdanielle theppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells AT akinyeketunde theppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells AT stewartlamonicav theppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells AT boldenadrienne ppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells AT bernardlynikka ppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells AT jonesdanielle ppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells AT akinyeketunde ppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells AT stewartlamonicav ppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells |