Cargando…
Estrogen Induction of Telomerase Activity through Regulation of the Mitogen-Activated Protein Kinase (MAPK) Dependent Pathway in Human Endometrial Cancer Cells
Given that prolonged exposure to estrogen and increased telomerase activity are associated with endometrial carcinogenesis, our objective was to evaluate the interaction between the MAPK pathway and estrogen induction of telomerase activity in endometrial cancer cells. Estradiol (E2) induced telomer...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3567109/ https://www.ncbi.nlm.nih.gov/pubmed/23409030 http://dx.doi.org/10.1371/journal.pone.0055730 |
_version_ | 1782258664833286144 |
---|---|
author | Zhou, Chunxiao Steplowski, Tara A. Dickens, Hallum K. Malloy, Kimberly M. Gehrig, Paola A. Boggess, John F. Bae-Jump, Victoria L. |
author_facet | Zhou, Chunxiao Steplowski, Tara A. Dickens, Hallum K. Malloy, Kimberly M. Gehrig, Paola A. Boggess, John F. Bae-Jump, Victoria L. |
author_sort | Zhou, Chunxiao |
collection | PubMed |
description | Given that prolonged exposure to estrogen and increased telomerase activity are associated with endometrial carcinogenesis, our objective was to evaluate the interaction between the MAPK pathway and estrogen induction of telomerase activity in endometrial cancer cells. Estradiol (E2) induced telomerase activity and hTERT mRNA expression in the estrogen receptor (ER)-α positive, Ishikawa endometrial cancer cell line. UO126, a highly selective inhibitor of MEK1/MEK2, inhibited telomerase activity and hTERT mRNA expression induced by E2. Similar results were also found after transfection with ERK 1/2-specific siRNA. Treatment with E2 resulted in rapid phosphorylation of p44/42 MAPK and increased MAPK activity which was abolished by UO126. The hTERT promoter contains two estrogen response elements (EREs), and luciferase assays demonstrate that these EREs are activated by E2. Exposure to UO126 or ERK 1/2-specific siRNA in combination with E2 counteracted the stimulatory effect of E2 on luciferase activity from these EREs. These findings suggest that E2-induction of telomerase activity is mediated via the MAPK pathway in human endometrial cancer cells. |
format | Online Article Text |
id | pubmed-3567109 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-35671092013-02-13 Estrogen Induction of Telomerase Activity through Regulation of the Mitogen-Activated Protein Kinase (MAPK) Dependent Pathway in Human Endometrial Cancer Cells Zhou, Chunxiao Steplowski, Tara A. Dickens, Hallum K. Malloy, Kimberly M. Gehrig, Paola A. Boggess, John F. Bae-Jump, Victoria L. PLoS One Research Article Given that prolonged exposure to estrogen and increased telomerase activity are associated with endometrial carcinogenesis, our objective was to evaluate the interaction between the MAPK pathway and estrogen induction of telomerase activity in endometrial cancer cells. Estradiol (E2) induced telomerase activity and hTERT mRNA expression in the estrogen receptor (ER)-α positive, Ishikawa endometrial cancer cell line. UO126, a highly selective inhibitor of MEK1/MEK2, inhibited telomerase activity and hTERT mRNA expression induced by E2. Similar results were also found after transfection with ERK 1/2-specific siRNA. Treatment with E2 resulted in rapid phosphorylation of p44/42 MAPK and increased MAPK activity which was abolished by UO126. The hTERT promoter contains two estrogen response elements (EREs), and luciferase assays demonstrate that these EREs are activated by E2. Exposure to UO126 or ERK 1/2-specific siRNA in combination with E2 counteracted the stimulatory effect of E2 on luciferase activity from these EREs. These findings suggest that E2-induction of telomerase activity is mediated via the MAPK pathway in human endometrial cancer cells. Public Library of Science 2013-02-07 /pmc/articles/PMC3567109/ /pubmed/23409030 http://dx.doi.org/10.1371/journal.pone.0055730 Text en © 2013 Zhou et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Zhou, Chunxiao Steplowski, Tara A. Dickens, Hallum K. Malloy, Kimberly M. Gehrig, Paola A. Boggess, John F. Bae-Jump, Victoria L. Estrogen Induction of Telomerase Activity through Regulation of the Mitogen-Activated Protein Kinase (MAPK) Dependent Pathway in Human Endometrial Cancer Cells |
title | Estrogen Induction of Telomerase Activity through Regulation of the Mitogen-Activated Protein Kinase (MAPK) Dependent Pathway in Human Endometrial Cancer Cells |
title_full | Estrogen Induction of Telomerase Activity through Regulation of the Mitogen-Activated Protein Kinase (MAPK) Dependent Pathway in Human Endometrial Cancer Cells |
title_fullStr | Estrogen Induction of Telomerase Activity through Regulation of the Mitogen-Activated Protein Kinase (MAPK) Dependent Pathway in Human Endometrial Cancer Cells |
title_full_unstemmed | Estrogen Induction of Telomerase Activity through Regulation of the Mitogen-Activated Protein Kinase (MAPK) Dependent Pathway in Human Endometrial Cancer Cells |
title_short | Estrogen Induction of Telomerase Activity through Regulation of the Mitogen-Activated Protein Kinase (MAPK) Dependent Pathway in Human Endometrial Cancer Cells |
title_sort | estrogen induction of telomerase activity through regulation of the mitogen-activated protein kinase (mapk) dependent pathway in human endometrial cancer cells |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3567109/ https://www.ncbi.nlm.nih.gov/pubmed/23409030 http://dx.doi.org/10.1371/journal.pone.0055730 |
work_keys_str_mv | AT zhouchunxiao estrogeninductionoftelomeraseactivitythroughregulationofthemitogenactivatedproteinkinasemapkdependentpathwayinhumanendometrialcancercells AT steplowskitaraa estrogeninductionoftelomeraseactivitythroughregulationofthemitogenactivatedproteinkinasemapkdependentpathwayinhumanendometrialcancercells AT dickenshallumk estrogeninductionoftelomeraseactivitythroughregulationofthemitogenactivatedproteinkinasemapkdependentpathwayinhumanendometrialcancercells AT malloykimberlym estrogeninductionoftelomeraseactivitythroughregulationofthemitogenactivatedproteinkinasemapkdependentpathwayinhumanendometrialcancercells AT gehrigpaolaa estrogeninductionoftelomeraseactivitythroughregulationofthemitogenactivatedproteinkinasemapkdependentpathwayinhumanendometrialcancercells AT boggessjohnf estrogeninductionoftelomeraseactivitythroughregulationofthemitogenactivatedproteinkinasemapkdependentpathwayinhumanendometrialcancercells AT baejumpvictorial estrogeninductionoftelomeraseactivitythroughregulationofthemitogenactivatedproteinkinasemapkdependentpathwayinhumanendometrialcancercells |