Cargando…

Allelic mRNA expression imbalance in C-type lectins reveals a frequent regulatory SNP in the human surfactant protein A (SP-A) gene

Genetic variation in C-type lectins influences infectious disease susceptibility but remains poorly understood. We employed allelic mRNA expression imbalance (AEI) technology for SP-A1, SP-A2, SP-D, DC-SIGN, MRC1, and Dectin-1, expressed in human macrophages and/or lung tissues. Frequent AEI, an ind...

Descripción completa

Detalles Bibliográficos
Autores principales: Azad, Abul K., Curtis, Amanda, Papp, Audrey, Webb, Amy, Knoell, Daren, Sadee, Wolfgang, Schlesinger, Larry S.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3594410/
https://www.ncbi.nlm.nih.gov/pubmed/23328842
http://dx.doi.org/10.1038/gene.2012.61
_version_ 1782262326811951104
author Azad, Abul K.
Curtis, Amanda
Papp, Audrey
Webb, Amy
Knoell, Daren
Sadee, Wolfgang
Schlesinger, Larry S.
author_facet Azad, Abul K.
Curtis, Amanda
Papp, Audrey
Webb, Amy
Knoell, Daren
Sadee, Wolfgang
Schlesinger, Larry S.
author_sort Azad, Abul K.
collection PubMed
description Genetic variation in C-type lectins influences infectious disease susceptibility but remains poorly understood. We employed allelic mRNA expression imbalance (AEI) technology for SP-A1, SP-A2, SP-D, DC-SIGN, MRC1, and Dectin-1, expressed in human macrophages and/or lung tissues. Frequent AEI, an indicator of regulatory polymorphisms, was observed in SP-A2, SP-D, and DC-SIGN. AEI was measured for SP-A2 in 38 lung tissues using four marker SNPs and was confirmed by next generation sequencing of one lung RNA sample. Genomic DNA at the SP-A2 DNA locus was sequenced by Ion Torrent technology in 16 samples. Correlation analysis of genotypes with AEI identified a haplotype block, and, specifically, the intronic SNP rs1650232 (30% MAF); the only variant consistently associated with an approximately two-fold change in mRNA allelic expression. Previously shown to alter a NAGNAG splice acceptor site with likely effects on SP-A2 expression, rs1650232 generates an alternative splice variant with three additional bases at the start of exon 3. Validated as a regulatory variant, rs1650232 is in partial LD with known SP-A2 marker SNPs previously associated with risk for respiratory diseases including tuberculosis. Applying functional DNA variants in clinical association studies, rather than marker SNPs, will advance our understanding of genetic susceptibility to infectious diseases.
format Online
Article
Text
id pubmed-3594410
institution National Center for Biotechnology Information
language English
publishDate 2013
record_format MEDLINE/PubMed
spelling pubmed-35944102013-09-01 Allelic mRNA expression imbalance in C-type lectins reveals a frequent regulatory SNP in the human surfactant protein A (SP-A) gene Azad, Abul K. Curtis, Amanda Papp, Audrey Webb, Amy Knoell, Daren Sadee, Wolfgang Schlesinger, Larry S. Genes Immun Article Genetic variation in C-type lectins influences infectious disease susceptibility but remains poorly understood. We employed allelic mRNA expression imbalance (AEI) technology for SP-A1, SP-A2, SP-D, DC-SIGN, MRC1, and Dectin-1, expressed in human macrophages and/or lung tissues. Frequent AEI, an indicator of regulatory polymorphisms, was observed in SP-A2, SP-D, and DC-SIGN. AEI was measured for SP-A2 in 38 lung tissues using four marker SNPs and was confirmed by next generation sequencing of one lung RNA sample. Genomic DNA at the SP-A2 DNA locus was sequenced by Ion Torrent technology in 16 samples. Correlation analysis of genotypes with AEI identified a haplotype block, and, specifically, the intronic SNP rs1650232 (30% MAF); the only variant consistently associated with an approximately two-fold change in mRNA allelic expression. Previously shown to alter a NAGNAG splice acceptor site with likely effects on SP-A2 expression, rs1650232 generates an alternative splice variant with three additional bases at the start of exon 3. Validated as a regulatory variant, rs1650232 is in partial LD with known SP-A2 marker SNPs previously associated with risk for respiratory diseases including tuberculosis. Applying functional DNA variants in clinical association studies, rather than marker SNPs, will advance our understanding of genetic susceptibility to infectious diseases. 2013-01-17 2013-03 /pmc/articles/PMC3594410/ /pubmed/23328842 http://dx.doi.org/10.1038/gene.2012.61 Text en Users may view, print, copy, download and text and data- mine the content in such documents, for the purposes of academic research, subject always to the full Conditions of use: http://www.nature.com/authors/editorial_policies/license.html#terms
spellingShingle Article
Azad, Abul K.
Curtis, Amanda
Papp, Audrey
Webb, Amy
Knoell, Daren
Sadee, Wolfgang
Schlesinger, Larry S.
Allelic mRNA expression imbalance in C-type lectins reveals a frequent regulatory SNP in the human surfactant protein A (SP-A) gene
title Allelic mRNA expression imbalance in C-type lectins reveals a frequent regulatory SNP in the human surfactant protein A (SP-A) gene
title_full Allelic mRNA expression imbalance in C-type lectins reveals a frequent regulatory SNP in the human surfactant protein A (SP-A) gene
title_fullStr Allelic mRNA expression imbalance in C-type lectins reveals a frequent regulatory SNP in the human surfactant protein A (SP-A) gene
title_full_unstemmed Allelic mRNA expression imbalance in C-type lectins reveals a frequent regulatory SNP in the human surfactant protein A (SP-A) gene
title_short Allelic mRNA expression imbalance in C-type lectins reveals a frequent regulatory SNP in the human surfactant protein A (SP-A) gene
title_sort allelic mrna expression imbalance in c-type lectins reveals a frequent regulatory snp in the human surfactant protein a (sp-a) gene
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3594410/
https://www.ncbi.nlm.nih.gov/pubmed/23328842
http://dx.doi.org/10.1038/gene.2012.61
work_keys_str_mv AT azadabulk allelicmrnaexpressionimbalanceinctypelectinsrevealsafrequentregulatorysnpinthehumansurfactantproteinaspagene
AT curtisamanda allelicmrnaexpressionimbalanceinctypelectinsrevealsafrequentregulatorysnpinthehumansurfactantproteinaspagene
AT pappaudrey allelicmrnaexpressionimbalanceinctypelectinsrevealsafrequentregulatorysnpinthehumansurfactantproteinaspagene
AT webbamy allelicmrnaexpressionimbalanceinctypelectinsrevealsafrequentregulatorysnpinthehumansurfactantproteinaspagene
AT knoelldaren allelicmrnaexpressionimbalanceinctypelectinsrevealsafrequentregulatorysnpinthehumansurfactantproteinaspagene
AT sadeewolfgang allelicmrnaexpressionimbalanceinctypelectinsrevealsafrequentregulatorysnpinthehumansurfactantproteinaspagene
AT schlesingerlarrys allelicmrnaexpressionimbalanceinctypelectinsrevealsafrequentregulatorysnpinthehumansurfactantproteinaspagene