Cargando…

Promoting Myelination in an In Vitro Mouse Model of the Peripheral Nerve System: The Effect of Wine Ingredients

Protective properties of moderate wine consumption against cancers, cardiovascular, metabolic and degenerative diseases have been reported in various clinical studies. Here, we analysed the effect of red wine (RW) and white wine (WW) on myelination using an in vitro embryonic co-culture mouse model....

Descripción completa

Detalles Bibliográficos
Autores principales: Stettner, Mark, Wolffram, Kathleen, Mausberg, Anne K., Albrecht, Philipp, Derksen, Angelika, Methner, Axel, Dehmel, Thomas, Hartung, Hans-Peter, Dietrich, Helmut, Kieseier, Bernd C.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3676361/
https://www.ncbi.nlm.nih.gov/pubmed/23762469
http://dx.doi.org/10.1371/journal.pone.0066079
_version_ 1782272627541278720
author Stettner, Mark
Wolffram, Kathleen
Mausberg, Anne K.
Albrecht, Philipp
Derksen, Angelika
Methner, Axel
Dehmel, Thomas
Hartung, Hans-Peter
Dietrich, Helmut
Kieseier, Bernd C.
author_facet Stettner, Mark
Wolffram, Kathleen
Mausberg, Anne K.
Albrecht, Philipp
Derksen, Angelika
Methner, Axel
Dehmel, Thomas
Hartung, Hans-Peter
Dietrich, Helmut
Kieseier, Bernd C.
author_sort Stettner, Mark
collection PubMed
description Protective properties of moderate wine consumption against cancers, cardiovascular, metabolic and degenerative diseases have been reported in various clinical studies. Here, we analysed the effect of red wine (RW) and white wine (WW) on myelination using an in vitro embryonic co-culture mouse model. The total amount of myelin was found to be significantly increased after RW and WW treatment, while only RW significantly increased the number of internodes. Both types of wine increased rat Schwann cell- (rSC) expression of the NAD+-dependent deacetylase sirtuin-two-homolog 2 (Sirt2), a protein known to be involved in myelination. Detailed chemical analysis of RW revealed a broad spectrum of anthocyanins, piceids, and phenolics, including resveratrol (RSV). In our assay system RSV in low concentrations induced myelination. Furthermore RSV raised intracellular glutathione concentrations in rSCs and in co-cultures and therefore augmented antioxidant capacity. We conclude that wine promotes myelination in a rodent in vitro model by controlling intracellular metabolism and SC plasticity. During this process, RSV exhibits protective properties; however, the fostering effect on myelinaton during exposure to wine appears to be a complex interaction of various compounds.
format Online
Article
Text
id pubmed-3676361
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-36763612013-06-12 Promoting Myelination in an In Vitro Mouse Model of the Peripheral Nerve System: The Effect of Wine Ingredients Stettner, Mark Wolffram, Kathleen Mausberg, Anne K. Albrecht, Philipp Derksen, Angelika Methner, Axel Dehmel, Thomas Hartung, Hans-Peter Dietrich, Helmut Kieseier, Bernd C. PLoS One Research Article Protective properties of moderate wine consumption against cancers, cardiovascular, metabolic and degenerative diseases have been reported in various clinical studies. Here, we analysed the effect of red wine (RW) and white wine (WW) on myelination using an in vitro embryonic co-culture mouse model. The total amount of myelin was found to be significantly increased after RW and WW treatment, while only RW significantly increased the number of internodes. Both types of wine increased rat Schwann cell- (rSC) expression of the NAD+-dependent deacetylase sirtuin-two-homolog 2 (Sirt2), a protein known to be involved in myelination. Detailed chemical analysis of RW revealed a broad spectrum of anthocyanins, piceids, and phenolics, including resveratrol (RSV). In our assay system RSV in low concentrations induced myelination. Furthermore RSV raised intracellular glutathione concentrations in rSCs and in co-cultures and therefore augmented antioxidant capacity. We conclude that wine promotes myelination in a rodent in vitro model by controlling intracellular metabolism and SC plasticity. During this process, RSV exhibits protective properties; however, the fostering effect on myelinaton during exposure to wine appears to be a complex interaction of various compounds. Public Library of Science 2013-06-07 /pmc/articles/PMC3676361/ /pubmed/23762469 http://dx.doi.org/10.1371/journal.pone.0066079 Text en © 2013 Stettner et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited.
spellingShingle Research Article
Stettner, Mark
Wolffram, Kathleen
Mausberg, Anne K.
Albrecht, Philipp
Derksen, Angelika
Methner, Axel
Dehmel, Thomas
Hartung, Hans-Peter
Dietrich, Helmut
Kieseier, Bernd C.
Promoting Myelination in an In Vitro Mouse Model of the Peripheral Nerve System: The Effect of Wine Ingredients
title Promoting Myelination in an In Vitro Mouse Model of the Peripheral Nerve System: The Effect of Wine Ingredients
title_full Promoting Myelination in an In Vitro Mouse Model of the Peripheral Nerve System: The Effect of Wine Ingredients
title_fullStr Promoting Myelination in an In Vitro Mouse Model of the Peripheral Nerve System: The Effect of Wine Ingredients
title_full_unstemmed Promoting Myelination in an In Vitro Mouse Model of the Peripheral Nerve System: The Effect of Wine Ingredients
title_short Promoting Myelination in an In Vitro Mouse Model of the Peripheral Nerve System: The Effect of Wine Ingredients
title_sort promoting myelination in an in vitro mouse model of the peripheral nerve system: the effect of wine ingredients
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3676361/
https://www.ncbi.nlm.nih.gov/pubmed/23762469
http://dx.doi.org/10.1371/journal.pone.0066079
work_keys_str_mv AT stettnermark promotingmyelinationinaninvitromousemodeloftheperipheralnervesystemtheeffectofwineingredients
AT wolfframkathleen promotingmyelinationinaninvitromousemodeloftheperipheralnervesystemtheeffectofwineingredients
AT mausbergannek promotingmyelinationinaninvitromousemodeloftheperipheralnervesystemtheeffectofwineingredients
AT albrechtphilipp promotingmyelinationinaninvitromousemodeloftheperipheralnervesystemtheeffectofwineingredients
AT derksenangelika promotingmyelinationinaninvitromousemodeloftheperipheralnervesystemtheeffectofwineingredients
AT methneraxel promotingmyelinationinaninvitromousemodeloftheperipheralnervesystemtheeffectofwineingredients
AT dehmelthomas promotingmyelinationinaninvitromousemodeloftheperipheralnervesystemtheeffectofwineingredients
AT hartunghanspeter promotingmyelinationinaninvitromousemodeloftheperipheralnervesystemtheeffectofwineingredients
AT dietrichhelmut promotingmyelinationinaninvitromousemodeloftheperipheralnervesystemtheeffectofwineingredients
AT kieseierberndc promotingmyelinationinaninvitromousemodeloftheperipheralnervesystemtheeffectofwineingredients