Cargando…
Promoting Myelination in an In Vitro Mouse Model of the Peripheral Nerve System: The Effect of Wine Ingredients
Protective properties of moderate wine consumption against cancers, cardiovascular, metabolic and degenerative diseases have been reported in various clinical studies. Here, we analysed the effect of red wine (RW) and white wine (WW) on myelination using an in vitro embryonic co-culture mouse model....
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3676361/ https://www.ncbi.nlm.nih.gov/pubmed/23762469 http://dx.doi.org/10.1371/journal.pone.0066079 |
_version_ | 1782272627541278720 |
---|---|
author | Stettner, Mark Wolffram, Kathleen Mausberg, Anne K. Albrecht, Philipp Derksen, Angelika Methner, Axel Dehmel, Thomas Hartung, Hans-Peter Dietrich, Helmut Kieseier, Bernd C. |
author_facet | Stettner, Mark Wolffram, Kathleen Mausberg, Anne K. Albrecht, Philipp Derksen, Angelika Methner, Axel Dehmel, Thomas Hartung, Hans-Peter Dietrich, Helmut Kieseier, Bernd C. |
author_sort | Stettner, Mark |
collection | PubMed |
description | Protective properties of moderate wine consumption against cancers, cardiovascular, metabolic and degenerative diseases have been reported in various clinical studies. Here, we analysed the effect of red wine (RW) and white wine (WW) on myelination using an in vitro embryonic co-culture mouse model. The total amount of myelin was found to be significantly increased after RW and WW treatment, while only RW significantly increased the number of internodes. Both types of wine increased rat Schwann cell- (rSC) expression of the NAD+-dependent deacetylase sirtuin-two-homolog 2 (Sirt2), a protein known to be involved in myelination. Detailed chemical analysis of RW revealed a broad spectrum of anthocyanins, piceids, and phenolics, including resveratrol (RSV). In our assay system RSV in low concentrations induced myelination. Furthermore RSV raised intracellular glutathione concentrations in rSCs and in co-cultures and therefore augmented antioxidant capacity. We conclude that wine promotes myelination in a rodent in vitro model by controlling intracellular metabolism and SC plasticity. During this process, RSV exhibits protective properties; however, the fostering effect on myelinaton during exposure to wine appears to be a complex interaction of various compounds. |
format | Online Article Text |
id | pubmed-3676361 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-36763612013-06-12 Promoting Myelination in an In Vitro Mouse Model of the Peripheral Nerve System: The Effect of Wine Ingredients Stettner, Mark Wolffram, Kathleen Mausberg, Anne K. Albrecht, Philipp Derksen, Angelika Methner, Axel Dehmel, Thomas Hartung, Hans-Peter Dietrich, Helmut Kieseier, Bernd C. PLoS One Research Article Protective properties of moderate wine consumption against cancers, cardiovascular, metabolic and degenerative diseases have been reported in various clinical studies. Here, we analysed the effect of red wine (RW) and white wine (WW) on myelination using an in vitro embryonic co-culture mouse model. The total amount of myelin was found to be significantly increased after RW and WW treatment, while only RW significantly increased the number of internodes. Both types of wine increased rat Schwann cell- (rSC) expression of the NAD+-dependent deacetylase sirtuin-two-homolog 2 (Sirt2), a protein known to be involved in myelination. Detailed chemical analysis of RW revealed a broad spectrum of anthocyanins, piceids, and phenolics, including resveratrol (RSV). In our assay system RSV in low concentrations induced myelination. Furthermore RSV raised intracellular glutathione concentrations in rSCs and in co-cultures and therefore augmented antioxidant capacity. We conclude that wine promotes myelination in a rodent in vitro model by controlling intracellular metabolism and SC plasticity. During this process, RSV exhibits protective properties; however, the fostering effect on myelinaton during exposure to wine appears to be a complex interaction of various compounds. Public Library of Science 2013-06-07 /pmc/articles/PMC3676361/ /pubmed/23762469 http://dx.doi.org/10.1371/journal.pone.0066079 Text en © 2013 Stettner et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Stettner, Mark Wolffram, Kathleen Mausberg, Anne K. Albrecht, Philipp Derksen, Angelika Methner, Axel Dehmel, Thomas Hartung, Hans-Peter Dietrich, Helmut Kieseier, Bernd C. Promoting Myelination in an In Vitro Mouse Model of the Peripheral Nerve System: The Effect of Wine Ingredients |
title | Promoting Myelination in an In Vitro Mouse Model of the Peripheral Nerve System: The Effect of Wine Ingredients |
title_full | Promoting Myelination in an In Vitro Mouse Model of the Peripheral Nerve System: The Effect of Wine Ingredients |
title_fullStr | Promoting Myelination in an In Vitro Mouse Model of the Peripheral Nerve System: The Effect of Wine Ingredients |
title_full_unstemmed | Promoting Myelination in an In Vitro Mouse Model of the Peripheral Nerve System: The Effect of Wine Ingredients |
title_short | Promoting Myelination in an In Vitro Mouse Model of the Peripheral Nerve System: The Effect of Wine Ingredients |
title_sort | promoting myelination in an in vitro mouse model of the peripheral nerve system: the effect of wine ingredients |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3676361/ https://www.ncbi.nlm.nih.gov/pubmed/23762469 http://dx.doi.org/10.1371/journal.pone.0066079 |
work_keys_str_mv | AT stettnermark promotingmyelinationinaninvitromousemodeloftheperipheralnervesystemtheeffectofwineingredients AT wolfframkathleen promotingmyelinationinaninvitromousemodeloftheperipheralnervesystemtheeffectofwineingredients AT mausbergannek promotingmyelinationinaninvitromousemodeloftheperipheralnervesystemtheeffectofwineingredients AT albrechtphilipp promotingmyelinationinaninvitromousemodeloftheperipheralnervesystemtheeffectofwineingredients AT derksenangelika promotingmyelinationinaninvitromousemodeloftheperipheralnervesystemtheeffectofwineingredients AT methneraxel promotingmyelinationinaninvitromousemodeloftheperipheralnervesystemtheeffectofwineingredients AT dehmelthomas promotingmyelinationinaninvitromousemodeloftheperipheralnervesystemtheeffectofwineingredients AT hartunghanspeter promotingmyelinationinaninvitromousemodeloftheperipheralnervesystemtheeffectofwineingredients AT dietrichhelmut promotingmyelinationinaninvitromousemodeloftheperipheralnervesystemtheeffectofwineingredients AT kieseierberndc promotingmyelinationinaninvitromousemodeloftheperipheralnervesystemtheeffectofwineingredients |