Cargando…

Both PKA and Epac Pathways Mediate N-Acetylcysteine-Induced Connexin43 Preservation in Rats with Myocardial Infarction

Cardiac remodeling was shown to be associated with reduced gap junction expression after myocardial infarction. A reduction in gap junctional proteins between myocytes may trigger ventricular arrhythmia. Therefore, we investigated whether N-acetylcysteine exerted antiarrhythmic effect by preserving...

Descripción completa

Detalles Bibliográficos
Autores principales: Lee, Tsung-Ming, Lin, Shinn-Zong, Chang, Nen-Chung
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3756050/
https://www.ncbi.nlm.nih.gov/pubmed/24015194
http://dx.doi.org/10.1371/journal.pone.0071878
_version_ 1782282029257195520
author Lee, Tsung-Ming
Lin, Shinn-Zong
Chang, Nen-Chung
author_facet Lee, Tsung-Ming
Lin, Shinn-Zong
Chang, Nen-Chung
author_sort Lee, Tsung-Ming
collection PubMed
description Cardiac remodeling was shown to be associated with reduced gap junction expression after myocardial infarction. A reduction in gap junctional proteins between myocytes may trigger ventricular arrhythmia. Therefore, we investigated whether N-acetylcysteine exerted antiarrhythmic effect by preserving connexin43 expression in postinfarcted rats, focusing on cAMP downstream molecules such as protein kinase A (PKA) and exchange protein directly activated by cAMP (Epac). Male Wistar rats after ligating coronary artery were randomized to either vehicle, or N-acetylcysteine for 4 weeks starting 24 hours after operation. Infarct size was similar between two groups. Compared with vehicle, cAMP levels were increased by N-acetylcysteine treatment after infarction. Myocardial connexin43 expression was significantly decreased in vehicle-treated infarcted rats compared with sham operated rats. Attenuated connexin43 expression and function were blunted after administering N-acetylcysteine, assessed by immunofluorescent analysis, dye coupling, Western blotting, and real-time quantitative RT-PCR of connexin43. Arrhythmic scores during programmed stimulation in the N-acetylcysteine-treated rats were significantly lower than those treated with vehicle. In an ex vivo study, enhanced connexin43 levels afforded by N-acetylcysteine were partially blocked by either H-89 (a PKA inhibitor) or brefeldin A (an Epac-signaling inhibitor) and completely blocked when H-89 and brefeldin A were given in combination. Addition of either the PKA specific activator N6Bz or Epac specific activator 8-CPT did not have additional increased connexin43 levels compared with rats treated with lithium chloride alone. These findings suggest that N-acetylcysteine protects ventricular arrhythmias by attenuating reduced connexin43 expression and function via both PKA- and Epac-dependent pathways, which converge through the inactivation of glycogen synthase kinase-3β.
format Online
Article
Text
id pubmed-3756050
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-37560502013-09-06 Both PKA and Epac Pathways Mediate N-Acetylcysteine-Induced Connexin43 Preservation in Rats with Myocardial Infarction Lee, Tsung-Ming Lin, Shinn-Zong Chang, Nen-Chung PLoS One Research Article Cardiac remodeling was shown to be associated with reduced gap junction expression after myocardial infarction. A reduction in gap junctional proteins between myocytes may trigger ventricular arrhythmia. Therefore, we investigated whether N-acetylcysteine exerted antiarrhythmic effect by preserving connexin43 expression in postinfarcted rats, focusing on cAMP downstream molecules such as protein kinase A (PKA) and exchange protein directly activated by cAMP (Epac). Male Wistar rats after ligating coronary artery were randomized to either vehicle, or N-acetylcysteine for 4 weeks starting 24 hours after operation. Infarct size was similar between two groups. Compared with vehicle, cAMP levels were increased by N-acetylcysteine treatment after infarction. Myocardial connexin43 expression was significantly decreased in vehicle-treated infarcted rats compared with sham operated rats. Attenuated connexin43 expression and function were blunted after administering N-acetylcysteine, assessed by immunofluorescent analysis, dye coupling, Western blotting, and real-time quantitative RT-PCR of connexin43. Arrhythmic scores during programmed stimulation in the N-acetylcysteine-treated rats were significantly lower than those treated with vehicle. In an ex vivo study, enhanced connexin43 levels afforded by N-acetylcysteine were partially blocked by either H-89 (a PKA inhibitor) or brefeldin A (an Epac-signaling inhibitor) and completely blocked when H-89 and brefeldin A were given in combination. Addition of either the PKA specific activator N6Bz or Epac specific activator 8-CPT did not have additional increased connexin43 levels compared with rats treated with lithium chloride alone. These findings suggest that N-acetylcysteine protects ventricular arrhythmias by attenuating reduced connexin43 expression and function via both PKA- and Epac-dependent pathways, which converge through the inactivation of glycogen synthase kinase-3β. Public Library of Science 2013-08-28 /pmc/articles/PMC3756050/ /pubmed/24015194 http://dx.doi.org/10.1371/journal.pone.0071878 Text en © 2013 Lee et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited.
spellingShingle Research Article
Lee, Tsung-Ming
Lin, Shinn-Zong
Chang, Nen-Chung
Both PKA and Epac Pathways Mediate N-Acetylcysteine-Induced Connexin43 Preservation in Rats with Myocardial Infarction
title Both PKA and Epac Pathways Mediate N-Acetylcysteine-Induced Connexin43 Preservation in Rats with Myocardial Infarction
title_full Both PKA and Epac Pathways Mediate N-Acetylcysteine-Induced Connexin43 Preservation in Rats with Myocardial Infarction
title_fullStr Both PKA and Epac Pathways Mediate N-Acetylcysteine-Induced Connexin43 Preservation in Rats with Myocardial Infarction
title_full_unstemmed Both PKA and Epac Pathways Mediate N-Acetylcysteine-Induced Connexin43 Preservation in Rats with Myocardial Infarction
title_short Both PKA and Epac Pathways Mediate N-Acetylcysteine-Induced Connexin43 Preservation in Rats with Myocardial Infarction
title_sort both pka and epac pathways mediate n-acetylcysteine-induced connexin43 preservation in rats with myocardial infarction
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3756050/
https://www.ncbi.nlm.nih.gov/pubmed/24015194
http://dx.doi.org/10.1371/journal.pone.0071878
work_keys_str_mv AT leetsungming bothpkaandepacpathwaysmediatenacetylcysteineinducedconnexin43preservationinratswithmyocardialinfarction
AT linshinnzong bothpkaandepacpathwaysmediatenacetylcysteineinducedconnexin43preservationinratswithmyocardialinfarction
AT changnenchung bothpkaandepacpathwaysmediatenacetylcysteineinducedconnexin43preservationinratswithmyocardialinfarction