Cargando…
p53/p21 Pathway Involved in Mediating Cellular Senescence of Bone Marrow-Derived Mesenchymal Stem Cells from Systemic Lupus Erythematosus Patients
Our and other groups have found that bone marrow-derived mesenchymal stem cells (BM-MSCs) from systemic lupus erythematosus (SLE) patients exhibited senescent behavior and are involved in the pathogenesis of SLE. Numerous studies have shown that activation of the p53/p21 pathway inhibits the prolife...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi Publishing Corporation
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3787636/ https://www.ncbi.nlm.nih.gov/pubmed/24151513 http://dx.doi.org/10.1155/2013/134243 |
_version_ | 1782286209705312256 |
---|---|
author | Gu, Zhifeng Jiang, Jinxia Tan, Wei Xia, Yunfei Cao, Haixia Meng, Yan Da, Zhanyun Liu, Hong Cheng, Chun |
author_facet | Gu, Zhifeng Jiang, Jinxia Tan, Wei Xia, Yunfei Cao, Haixia Meng, Yan Da, Zhanyun Liu, Hong Cheng, Chun |
author_sort | Gu, Zhifeng |
collection | PubMed |
description | Our and other groups have found that bone marrow-derived mesenchymal stem cells (BM-MSCs) from systemic lupus erythematosus (SLE) patients exhibited senescent behavior and are involved in the pathogenesis of SLE. Numerous studies have shown that activation of the p53/p21 pathway inhibits the proliferation of BM-MSCs. The aim of this study was to determine whether p53/p21 pathway is involved in regulating the aging of BM-MSCs from SLE patients and the underlying mechanisms. We further confirmed that BM-MSCs from SLE patients showed characteristics of senescence. The expressions of p53 and p21 were significantly increased, whereas levels of Cyclin E, cyclin-dependent kinase-2, and phosphorylation of retinoblastoma protein were decreased in the BM-MSCs from SLE patients and knockdown of p21 expression reversed the senescent features of BM-MSCs from SLE patients. Our results demonstrated that p53/p21 pathway played an important role in the senescence process of BM-MSCs from SLE. |
format | Online Article Text |
id | pubmed-3787636 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | Hindawi Publishing Corporation |
record_format | MEDLINE/PubMed |
spelling | pubmed-37876362013-10-22 p53/p21 Pathway Involved in Mediating Cellular Senescence of Bone Marrow-Derived Mesenchymal Stem Cells from Systemic Lupus Erythematosus Patients Gu, Zhifeng Jiang, Jinxia Tan, Wei Xia, Yunfei Cao, Haixia Meng, Yan Da, Zhanyun Liu, Hong Cheng, Chun Clin Dev Immunol Research Article Our and other groups have found that bone marrow-derived mesenchymal stem cells (BM-MSCs) from systemic lupus erythematosus (SLE) patients exhibited senescent behavior and are involved in the pathogenesis of SLE. Numerous studies have shown that activation of the p53/p21 pathway inhibits the proliferation of BM-MSCs. The aim of this study was to determine whether p53/p21 pathway is involved in regulating the aging of BM-MSCs from SLE patients and the underlying mechanisms. We further confirmed that BM-MSCs from SLE patients showed characteristics of senescence. The expressions of p53 and p21 were significantly increased, whereas levels of Cyclin E, cyclin-dependent kinase-2, and phosphorylation of retinoblastoma protein were decreased in the BM-MSCs from SLE patients and knockdown of p21 expression reversed the senescent features of BM-MSCs from SLE patients. Our results demonstrated that p53/p21 pathway played an important role in the senescence process of BM-MSCs from SLE. Hindawi Publishing Corporation 2013 2013-09-16 /pmc/articles/PMC3787636/ /pubmed/24151513 http://dx.doi.org/10.1155/2013/134243 Text en Copyright © 2013 Zhifeng Gu et al. https://creativecommons.org/licenses/by/3.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Gu, Zhifeng Jiang, Jinxia Tan, Wei Xia, Yunfei Cao, Haixia Meng, Yan Da, Zhanyun Liu, Hong Cheng, Chun p53/p21 Pathway Involved in Mediating Cellular Senescence of Bone Marrow-Derived Mesenchymal Stem Cells from Systemic Lupus Erythematosus Patients |
title | p53/p21 Pathway Involved in Mediating Cellular Senescence of Bone Marrow-Derived Mesenchymal Stem Cells from Systemic Lupus Erythematosus Patients |
title_full | p53/p21 Pathway Involved in Mediating Cellular Senescence of Bone Marrow-Derived Mesenchymal Stem Cells from Systemic Lupus Erythematosus Patients |
title_fullStr | p53/p21 Pathway Involved in Mediating Cellular Senescence of Bone Marrow-Derived Mesenchymal Stem Cells from Systemic Lupus Erythematosus Patients |
title_full_unstemmed | p53/p21 Pathway Involved in Mediating Cellular Senescence of Bone Marrow-Derived Mesenchymal Stem Cells from Systemic Lupus Erythematosus Patients |
title_short | p53/p21 Pathway Involved in Mediating Cellular Senescence of Bone Marrow-Derived Mesenchymal Stem Cells from Systemic Lupus Erythematosus Patients |
title_sort | p53/p21 pathway involved in mediating cellular senescence of bone marrow-derived mesenchymal stem cells from systemic lupus erythematosus patients |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3787636/ https://www.ncbi.nlm.nih.gov/pubmed/24151513 http://dx.doi.org/10.1155/2013/134243 |
work_keys_str_mv | AT guzhifeng p53p21pathwayinvolvedinmediatingcellularsenescenceofbonemarrowderivedmesenchymalstemcellsfromsystemiclupuserythematosuspatients AT jiangjinxia p53p21pathwayinvolvedinmediatingcellularsenescenceofbonemarrowderivedmesenchymalstemcellsfromsystemiclupuserythematosuspatients AT tanwei p53p21pathwayinvolvedinmediatingcellularsenescenceofbonemarrowderivedmesenchymalstemcellsfromsystemiclupuserythematosuspatients AT xiayunfei p53p21pathwayinvolvedinmediatingcellularsenescenceofbonemarrowderivedmesenchymalstemcellsfromsystemiclupuserythematosuspatients AT caohaixia p53p21pathwayinvolvedinmediatingcellularsenescenceofbonemarrowderivedmesenchymalstemcellsfromsystemiclupuserythematosuspatients AT mengyan p53p21pathwayinvolvedinmediatingcellularsenescenceofbonemarrowderivedmesenchymalstemcellsfromsystemiclupuserythematosuspatients AT dazhanyun p53p21pathwayinvolvedinmediatingcellularsenescenceofbonemarrowderivedmesenchymalstemcellsfromsystemiclupuserythematosuspatients AT liuhong p53p21pathwayinvolvedinmediatingcellularsenescenceofbonemarrowderivedmesenchymalstemcellsfromsystemiclupuserythematosuspatients AT chengchun p53p21pathwayinvolvedinmediatingcellularsenescenceofbonemarrowderivedmesenchymalstemcellsfromsystemiclupuserythematosuspatients |