Cargando…

hTERT deficiency in naïve T cells affects lymphocyte homeostasis in myelodysplastic syndrome patients

Myelodysplastic syndromes (MDSs) are hematopoietic stem cell disorders with a high potential to develop into acute myeloid leukemia (AML). We have recently demonstrated that naïve T cells, but not memory T cells, from MDS patients exhibit a pronounced deficiency in the mRNA coding for the catalytic...

Descripción completa

Detalles Bibliográficos
Autores principales: Yang, Lili, Eksioglu, Erika A, Wei, Sheng
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Landes Bioscience 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3875656/
https://www.ncbi.nlm.nih.gov/pubmed/24386611
http://dx.doi.org/10.4161/onci.26329
_version_ 1782297392086777856
author Yang, Lili
Eksioglu, Erika A
Wei, Sheng
author_facet Yang, Lili
Eksioglu, Erika A
Wei, Sheng
author_sort Yang, Lili
collection PubMed
description Myelodysplastic syndromes (MDSs) are hematopoietic stem cell disorders with a high potential to develop into acute myeloid leukemia (AML). We have recently demonstrated that naïve T cells, but not memory T cells, from MDS patients exhibit a pronounced deficiency in the mRNA coding for the catalytic subunit of telomerase (hTERT). We discuss the importance of this finding for lymphocytic homeostasis in MDS patients.
format Online
Article
Text
id pubmed-3875656
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher Landes Bioscience
record_format MEDLINE/PubMed
spelling pubmed-38756562014-01-02 hTERT deficiency in naïve T cells affects lymphocyte homeostasis in myelodysplastic syndrome patients Yang, Lili Eksioglu, Erika A Wei, Sheng Oncoimmunology Author's View Myelodysplastic syndromes (MDSs) are hematopoietic stem cell disorders with a high potential to develop into acute myeloid leukemia (AML). We have recently demonstrated that naïve T cells, but not memory T cells, from MDS patients exhibit a pronounced deficiency in the mRNA coding for the catalytic subunit of telomerase (hTERT). We discuss the importance of this finding for lymphocytic homeostasis in MDS patients. Landes Bioscience 2013-11-01 2013-10-09 /pmc/articles/PMC3875656/ /pubmed/24386611 http://dx.doi.org/10.4161/onci.26329 Text en Copyright © 2013 Landes Bioscience http://creativecommons.org/licenses/by-nc/3.0/ This is an open-access article licensed under a Creative Commons Attribution-NonCommercial 3.0 Unported License. The article may be redistributed, reproduced, and reused for non-commercial purposes, provided the original source is properly cited.
spellingShingle Author's View
Yang, Lili
Eksioglu, Erika A
Wei, Sheng
hTERT deficiency in naïve T cells affects lymphocyte homeostasis in myelodysplastic syndrome patients
title hTERT deficiency in naïve T cells affects lymphocyte homeostasis in myelodysplastic syndrome patients
title_full hTERT deficiency in naïve T cells affects lymphocyte homeostasis in myelodysplastic syndrome patients
title_fullStr hTERT deficiency in naïve T cells affects lymphocyte homeostasis in myelodysplastic syndrome patients
title_full_unstemmed hTERT deficiency in naïve T cells affects lymphocyte homeostasis in myelodysplastic syndrome patients
title_short hTERT deficiency in naïve T cells affects lymphocyte homeostasis in myelodysplastic syndrome patients
title_sort htert deficiency in naïve t cells affects lymphocyte homeostasis in myelodysplastic syndrome patients
topic Author's View
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3875656/
https://www.ncbi.nlm.nih.gov/pubmed/24386611
http://dx.doi.org/10.4161/onci.26329
work_keys_str_mv AT yanglili htertdeficiencyinnaivetcellsaffectslymphocytehomeostasisinmyelodysplasticsyndromepatients
AT eksiogluerikaa htertdeficiencyinnaivetcellsaffectslymphocytehomeostasisinmyelodysplasticsyndromepatients
AT weisheng htertdeficiencyinnaivetcellsaffectslymphocytehomeostasisinmyelodysplasticsyndromepatients