Cargando…

Effects of supplementing n-3 fatty acid enriched eggs and walnuts on cardiovascular disease risk markers in healthy free-living lacto-ovo-vegetarians: a randomized, crossover, free-living intervention study

BACKGROUND: Plant and marine n-3 fatty acids (FA) may favorably modify select markers of cardiovascular disease risk. Whether supplementing the habitual diet of lacto-ovo-vegetarians (LOV) with walnuts (containing α-linolenic acid, ALA) and n-3 FA enriched eggs (containing primarily docosahexaenoic...

Descripción completa

Detalles Bibliográficos
Autores principales: Burns-Whitmore, Bonny, Haddad, Ella, Sabaté, Joan, Rajaram, Sujatha
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4001106/
https://www.ncbi.nlm.nih.gov/pubmed/24673793
http://dx.doi.org/10.1186/1475-2891-13-29
_version_ 1782313705109716992
author Burns-Whitmore, Bonny
Haddad, Ella
Sabaté, Joan
Rajaram, Sujatha
author_facet Burns-Whitmore, Bonny
Haddad, Ella
Sabaté, Joan
Rajaram, Sujatha
author_sort Burns-Whitmore, Bonny
collection PubMed
description BACKGROUND: Plant and marine n-3 fatty acids (FA) may favorably modify select markers of cardiovascular disease risk. Whether supplementing the habitual diet of lacto-ovo-vegetarians (LOV) with walnuts (containing α-linolenic acid, ALA) and n-3 FA enriched eggs (containing primarily docosahexaenoic acid, DHA and ALA) would have equivalent effects on CVD risk factors is explored in this study. METHODS: In this study, 20 healthy free-living LOVs following their habitual diet were randomly assigned in a crossover design to receive one of three supplements: n-3 FA enriched egg (6/week), walnuts (28.4 g, 6/week) or a standard egg, 6/week (control) for 8 weeks each with 4-wk washout between treatments. Erythrocyte membrane fatty acids, serum lipids and inflammatory markers were measured at the end of each treatment. RESULTS: Dietary compliance was observed by an expected increase in erythrocyte membrane ALA following the walnut treatment and in DHA following the n-3 FA enriched egg treatment. Walnut treatment lowered serum triacylglycerol, total cholesterol and Apo B (p < 0.05) compared to the standard egg but not the n-3 FA enriched egg treatment. However, walnut treatment significantly reduced total: HDL cholesterol ratio compared to both egg treatments. There were no differences between treatments for any of the inflammatory markers. CONCLUSIONS: For LOV, a direct source of DHA such as n-3 FA enriched eggs seems necessary to increase membrane levels of DHA. However for producing an overall favorable blood lipid profile, daily consumption of a handful of walnuts rich in ALA may be a preferred option for lacto-ovo vegetarian.
format Online
Article
Text
id pubmed-4001106
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-40011062014-04-29 Effects of supplementing n-3 fatty acid enriched eggs and walnuts on cardiovascular disease risk markers in healthy free-living lacto-ovo-vegetarians: a randomized, crossover, free-living intervention study Burns-Whitmore, Bonny Haddad, Ella Sabaté, Joan Rajaram, Sujatha Nutr J Research BACKGROUND: Plant and marine n-3 fatty acids (FA) may favorably modify select markers of cardiovascular disease risk. Whether supplementing the habitual diet of lacto-ovo-vegetarians (LOV) with walnuts (containing α-linolenic acid, ALA) and n-3 FA enriched eggs (containing primarily docosahexaenoic acid, DHA and ALA) would have equivalent effects on CVD risk factors is explored in this study. METHODS: In this study, 20 healthy free-living LOVs following their habitual diet were randomly assigned in a crossover design to receive one of three supplements: n-3 FA enriched egg (6/week), walnuts (28.4 g, 6/week) or a standard egg, 6/week (control) for 8 weeks each with 4-wk washout between treatments. Erythrocyte membrane fatty acids, serum lipids and inflammatory markers were measured at the end of each treatment. RESULTS: Dietary compliance was observed by an expected increase in erythrocyte membrane ALA following the walnut treatment and in DHA following the n-3 FA enriched egg treatment. Walnut treatment lowered serum triacylglycerol, total cholesterol and Apo B (p < 0.05) compared to the standard egg but not the n-3 FA enriched egg treatment. However, walnut treatment significantly reduced total: HDL cholesterol ratio compared to both egg treatments. There were no differences between treatments for any of the inflammatory markers. CONCLUSIONS: For LOV, a direct source of DHA such as n-3 FA enriched eggs seems necessary to increase membrane levels of DHA. However for producing an overall favorable blood lipid profile, daily consumption of a handful of walnuts rich in ALA may be a preferred option for lacto-ovo vegetarian. BioMed Central 2014-03-27 /pmc/articles/PMC4001106/ /pubmed/24673793 http://dx.doi.org/10.1186/1475-2891-13-29 Text en Copyright © 2014 Burns-Whitmore et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Burns-Whitmore, Bonny
Haddad, Ella
Sabaté, Joan
Rajaram, Sujatha
Effects of supplementing n-3 fatty acid enriched eggs and walnuts on cardiovascular disease risk markers in healthy free-living lacto-ovo-vegetarians: a randomized, crossover, free-living intervention study
title Effects of supplementing n-3 fatty acid enriched eggs and walnuts on cardiovascular disease risk markers in healthy free-living lacto-ovo-vegetarians: a randomized, crossover, free-living intervention study
title_full Effects of supplementing n-3 fatty acid enriched eggs and walnuts on cardiovascular disease risk markers in healthy free-living lacto-ovo-vegetarians: a randomized, crossover, free-living intervention study
title_fullStr Effects of supplementing n-3 fatty acid enriched eggs and walnuts on cardiovascular disease risk markers in healthy free-living lacto-ovo-vegetarians: a randomized, crossover, free-living intervention study
title_full_unstemmed Effects of supplementing n-3 fatty acid enriched eggs and walnuts on cardiovascular disease risk markers in healthy free-living lacto-ovo-vegetarians: a randomized, crossover, free-living intervention study
title_short Effects of supplementing n-3 fatty acid enriched eggs and walnuts on cardiovascular disease risk markers in healthy free-living lacto-ovo-vegetarians: a randomized, crossover, free-living intervention study
title_sort effects of supplementing n-3 fatty acid enriched eggs and walnuts on cardiovascular disease risk markers in healthy free-living lacto-ovo-vegetarians: a randomized, crossover, free-living intervention study
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4001106/
https://www.ncbi.nlm.nih.gov/pubmed/24673793
http://dx.doi.org/10.1186/1475-2891-13-29
work_keys_str_mv AT burnswhitmorebonny effectsofsupplementingn3fattyacidenrichedeggsandwalnutsoncardiovasculardiseaseriskmarkersinhealthyfreelivinglactoovovegetariansarandomizedcrossoverfreelivinginterventionstudy
AT haddadella effectsofsupplementingn3fattyacidenrichedeggsandwalnutsoncardiovasculardiseaseriskmarkersinhealthyfreelivinglactoovovegetariansarandomizedcrossoverfreelivinginterventionstudy
AT sabatejoan effectsofsupplementingn3fattyacidenrichedeggsandwalnutsoncardiovasculardiseaseriskmarkersinhealthyfreelivinglactoovovegetariansarandomizedcrossoverfreelivinginterventionstudy
AT rajaramsujatha effectsofsupplementingn3fattyacidenrichedeggsandwalnutsoncardiovasculardiseaseriskmarkersinhealthyfreelivinglactoovovegetariansarandomizedcrossoverfreelivinginterventionstudy