Cargando…
The tyrosine phosphatase Ptpn22 discriminates weak, self-peptide from strong agonist T cell receptor signals
T cells must be tolerant of self-antigens to avoid autoimmunity, but responsive to foreign-antigens to provide protection against infection. We found that in both naive and effector T cells, the tyrosine phosphatase, Ptpn22 limits T cell receptor signaling by weak agonist and self-antigens, while no...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4148831/ https://www.ncbi.nlm.nih.gov/pubmed/25108421 http://dx.doi.org/10.1038/ni.2958 |
_version_ | 1782332677876088832 |
---|---|
author | Salmond, Robert J. Brownlie, Rebecca J. Morrison, Vicky L. Zamoyska, Rose |
author_facet | Salmond, Robert J. Brownlie, Rebecca J. Morrison, Vicky L. Zamoyska, Rose |
author_sort | Salmond, Robert J. |
collection | PubMed |
description | T cells must be tolerant of self-antigens to avoid autoimmunity, but responsive to foreign-antigens to provide protection against infection. We found that in both naive and effector T cells, the tyrosine phosphatase, Ptpn22 limits T cell receptor signaling by weak agonist and self-antigens, while not impeding responses to strong agonist antigens. T cells lacking Ptpn22 show enhanced conjugate formation with antigen presenting cells pulsed with weak peptides, leading to their activation and production of inflammatory cytokines. This effect is exacerbated under conditions of lymphopenia with the formation of potent memory T cells in the absence of Ptpn22. These data address how loss of function PTPN22 alleles can lead to expansion of effector/memory T cells and a predisposition to human autoimmunity. |
format | Online Article Text |
id | pubmed-4148831 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
record_format | MEDLINE/PubMed |
spelling | pubmed-41488312015-03-01 The tyrosine phosphatase Ptpn22 discriminates weak, self-peptide from strong agonist T cell receptor signals Salmond, Robert J. Brownlie, Rebecca J. Morrison, Vicky L. Zamoyska, Rose Nat Immunol Article T cells must be tolerant of self-antigens to avoid autoimmunity, but responsive to foreign-antigens to provide protection against infection. We found that in both naive and effector T cells, the tyrosine phosphatase, Ptpn22 limits T cell receptor signaling by weak agonist and self-antigens, while not impeding responses to strong agonist antigens. T cells lacking Ptpn22 show enhanced conjugate formation with antigen presenting cells pulsed with weak peptides, leading to their activation and production of inflammatory cytokines. This effect is exacerbated under conditions of lymphopenia with the formation of potent memory T cells in the absence of Ptpn22. These data address how loss of function PTPN22 alleles can lead to expansion of effector/memory T cells and a predisposition to human autoimmunity. 2014-08-10 2014-09 /pmc/articles/PMC4148831/ /pubmed/25108421 http://dx.doi.org/10.1038/ni.2958 Text en Users may view, print, copy, and download text and data-mine the content in such documents, for the purposes of academic research, subject always to the full Conditions of use:http://www.nature.com/authors/editorial_policies/license.html#terms |
spellingShingle | Article Salmond, Robert J. Brownlie, Rebecca J. Morrison, Vicky L. Zamoyska, Rose The tyrosine phosphatase Ptpn22 discriminates weak, self-peptide from strong agonist T cell receptor signals |
title | The tyrosine phosphatase Ptpn22 discriminates weak, self-peptide from strong agonist T cell receptor signals |
title_full | The tyrosine phosphatase Ptpn22 discriminates weak, self-peptide from strong agonist T cell receptor signals |
title_fullStr | The tyrosine phosphatase Ptpn22 discriminates weak, self-peptide from strong agonist T cell receptor signals |
title_full_unstemmed | The tyrosine phosphatase Ptpn22 discriminates weak, self-peptide from strong agonist T cell receptor signals |
title_short | The tyrosine phosphatase Ptpn22 discriminates weak, self-peptide from strong agonist T cell receptor signals |
title_sort | tyrosine phosphatase ptpn22 discriminates weak, self-peptide from strong agonist t cell receptor signals |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4148831/ https://www.ncbi.nlm.nih.gov/pubmed/25108421 http://dx.doi.org/10.1038/ni.2958 |
work_keys_str_mv | AT salmondrobertj thetyrosinephosphataseptpn22discriminatesweakselfpeptidefromstrongagonisttcellreceptorsignals AT brownlierebeccaj thetyrosinephosphataseptpn22discriminatesweakselfpeptidefromstrongagonisttcellreceptorsignals AT morrisonvickyl thetyrosinephosphataseptpn22discriminatesweakselfpeptidefromstrongagonisttcellreceptorsignals AT zamoyskarose thetyrosinephosphataseptpn22discriminatesweakselfpeptidefromstrongagonisttcellreceptorsignals AT salmondrobertj tyrosinephosphataseptpn22discriminatesweakselfpeptidefromstrongagonisttcellreceptorsignals AT brownlierebeccaj tyrosinephosphataseptpn22discriminatesweakselfpeptidefromstrongagonisttcellreceptorsignals AT morrisonvickyl tyrosinephosphataseptpn22discriminatesweakselfpeptidefromstrongagonisttcellreceptorsignals AT zamoyskarose tyrosinephosphataseptpn22discriminatesweakselfpeptidefromstrongagonisttcellreceptorsignals |