Cargando…

The tyrosine phosphatase Ptpn22 discriminates weak, self-peptide from strong agonist T cell receptor signals

T cells must be tolerant of self-antigens to avoid autoimmunity, but responsive to foreign-antigens to provide protection against infection. We found that in both naive and effector T cells, the tyrosine phosphatase, Ptpn22 limits T cell receptor signaling by weak agonist and self-antigens, while no...

Descripción completa

Detalles Bibliográficos
Autores principales: Salmond, Robert J., Brownlie, Rebecca J., Morrison, Vicky L., Zamoyska, Rose
Formato: Online Artículo Texto
Lenguaje:English
Publicado: 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4148831/
https://www.ncbi.nlm.nih.gov/pubmed/25108421
http://dx.doi.org/10.1038/ni.2958
_version_ 1782332677876088832
author Salmond, Robert J.
Brownlie, Rebecca J.
Morrison, Vicky L.
Zamoyska, Rose
author_facet Salmond, Robert J.
Brownlie, Rebecca J.
Morrison, Vicky L.
Zamoyska, Rose
author_sort Salmond, Robert J.
collection PubMed
description T cells must be tolerant of self-antigens to avoid autoimmunity, but responsive to foreign-antigens to provide protection against infection. We found that in both naive and effector T cells, the tyrosine phosphatase, Ptpn22 limits T cell receptor signaling by weak agonist and self-antigens, while not impeding responses to strong agonist antigens. T cells lacking Ptpn22 show enhanced conjugate formation with antigen presenting cells pulsed with weak peptides, leading to their activation and production of inflammatory cytokines. This effect is exacerbated under conditions of lymphopenia with the formation of potent memory T cells in the absence of Ptpn22. These data address how loss of function PTPN22 alleles can lead to expansion of effector/memory T cells and a predisposition to human autoimmunity.
format Online
Article
Text
id pubmed-4148831
institution National Center for Biotechnology Information
language English
publishDate 2014
record_format MEDLINE/PubMed
spelling pubmed-41488312015-03-01 The tyrosine phosphatase Ptpn22 discriminates weak, self-peptide from strong agonist T cell receptor signals Salmond, Robert J. Brownlie, Rebecca J. Morrison, Vicky L. Zamoyska, Rose Nat Immunol Article T cells must be tolerant of self-antigens to avoid autoimmunity, but responsive to foreign-antigens to provide protection against infection. We found that in both naive and effector T cells, the tyrosine phosphatase, Ptpn22 limits T cell receptor signaling by weak agonist and self-antigens, while not impeding responses to strong agonist antigens. T cells lacking Ptpn22 show enhanced conjugate formation with antigen presenting cells pulsed with weak peptides, leading to their activation and production of inflammatory cytokines. This effect is exacerbated under conditions of lymphopenia with the formation of potent memory T cells in the absence of Ptpn22. These data address how loss of function PTPN22 alleles can lead to expansion of effector/memory T cells and a predisposition to human autoimmunity. 2014-08-10 2014-09 /pmc/articles/PMC4148831/ /pubmed/25108421 http://dx.doi.org/10.1038/ni.2958 Text en Users may view, print, copy, and download text and data-mine the content in such documents, for the purposes of academic research, subject always to the full Conditions of use:http://www.nature.com/authors/editorial_policies/license.html#terms
spellingShingle Article
Salmond, Robert J.
Brownlie, Rebecca J.
Morrison, Vicky L.
Zamoyska, Rose
The tyrosine phosphatase Ptpn22 discriminates weak, self-peptide from strong agonist T cell receptor signals
title The tyrosine phosphatase Ptpn22 discriminates weak, self-peptide from strong agonist T cell receptor signals
title_full The tyrosine phosphatase Ptpn22 discriminates weak, self-peptide from strong agonist T cell receptor signals
title_fullStr The tyrosine phosphatase Ptpn22 discriminates weak, self-peptide from strong agonist T cell receptor signals
title_full_unstemmed The tyrosine phosphatase Ptpn22 discriminates weak, self-peptide from strong agonist T cell receptor signals
title_short The tyrosine phosphatase Ptpn22 discriminates weak, self-peptide from strong agonist T cell receptor signals
title_sort tyrosine phosphatase ptpn22 discriminates weak, self-peptide from strong agonist t cell receptor signals
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4148831/
https://www.ncbi.nlm.nih.gov/pubmed/25108421
http://dx.doi.org/10.1038/ni.2958
work_keys_str_mv AT salmondrobertj thetyrosinephosphataseptpn22discriminatesweakselfpeptidefromstrongagonisttcellreceptorsignals
AT brownlierebeccaj thetyrosinephosphataseptpn22discriminatesweakselfpeptidefromstrongagonisttcellreceptorsignals
AT morrisonvickyl thetyrosinephosphataseptpn22discriminatesweakselfpeptidefromstrongagonisttcellreceptorsignals
AT zamoyskarose thetyrosinephosphataseptpn22discriminatesweakselfpeptidefromstrongagonisttcellreceptorsignals
AT salmondrobertj tyrosinephosphataseptpn22discriminatesweakselfpeptidefromstrongagonisttcellreceptorsignals
AT brownlierebeccaj tyrosinephosphataseptpn22discriminatesweakselfpeptidefromstrongagonisttcellreceptorsignals
AT morrisonvickyl tyrosinephosphataseptpn22discriminatesweakselfpeptidefromstrongagonisttcellreceptorsignals
AT zamoyskarose tyrosinephosphataseptpn22discriminatesweakselfpeptidefromstrongagonisttcellreceptorsignals