Cargando…
Structural chromosome abnormalities, increased DNA strand breaks and DNA strand break repair deficiency in dermal fibroblasts from old female human donors
Dermal fibroblasts provide a paradigmatic model of cellular adaptation to long-term exogenous stress and ageing processes driven thereby. Here we addressed whether fibroblast ageing analysed ex vivo entails genome instability. Dermal fibroblasts from human female donors aged 20–67 years were studied...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Impact Journals LLC
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4359693/ https://www.ncbi.nlm.nih.gov/pubmed/25678531 |
_version_ | 1782361448506195968 |
---|---|
author | Kalfalah, Faiza Seggewiß, Sabine Walter, Regina Tigges, Julia Moreno-Villanueva, María Bürkle, Alexander Ohse, Sebastian Busch, Hauke Boerries, Melanie Hildebrandt, Barbara Royer-Pokora, Brigitte Boege, Fritz |
author_facet | Kalfalah, Faiza Seggewiß, Sabine Walter, Regina Tigges, Julia Moreno-Villanueva, María Bürkle, Alexander Ohse, Sebastian Busch, Hauke Boerries, Melanie Hildebrandt, Barbara Royer-Pokora, Brigitte Boege, Fritz |
author_sort | Kalfalah, Faiza |
collection | PubMed |
description | Dermal fibroblasts provide a paradigmatic model of cellular adaptation to long-term exogenous stress and ageing processes driven thereby. Here we addressed whether fibroblast ageing analysed ex vivo entails genome instability. Dermal fibroblasts from human female donors aged 20–67 years were studied in primary culture at low population doubling. Under these conditions, the incidence of replicative senescence and rates of age-correlated telomere shortening were insignificant. Genome-wide gene expression analysis revealed age-related impairment of mitosis, telomere and chromosome maintenance and induction of genes associated with DNA repair and non-homologous end-joining, most notably XRCC4 and ligase 4. We observed an age-correlated drop in proliferative capacity and age-correlated increases in heterochromatin marks, structural chromosome abnormalities (deletions, translocations and chromatid breaks), DNA strand breaks and histone H2AX-phosphorylation. In a third of the cells from old and middle-aged donors repair of X-ray induced DNA strand breaks was impaired despite up-regulation of DNA repair genes. The distinct phenotype of genome instability, increased heterochromatinisation and (in 30% of the cases futile) up-regulation of DNA repair genes was stably maintained over several cell passages indicating that it represents a feature of geroconversion that is distinct from cellular senescence, as it does not encompass a block of proliferation. |
format | Online Article Text |
id | pubmed-4359693 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | Impact Journals LLC |
record_format | MEDLINE/PubMed |
spelling | pubmed-43596932015-03-27 Structural chromosome abnormalities, increased DNA strand breaks and DNA strand break repair deficiency in dermal fibroblasts from old female human donors Kalfalah, Faiza Seggewiß, Sabine Walter, Regina Tigges, Julia Moreno-Villanueva, María Bürkle, Alexander Ohse, Sebastian Busch, Hauke Boerries, Melanie Hildebrandt, Barbara Royer-Pokora, Brigitte Boege, Fritz Aging (Albany NY) Research Paper Dermal fibroblasts provide a paradigmatic model of cellular adaptation to long-term exogenous stress and ageing processes driven thereby. Here we addressed whether fibroblast ageing analysed ex vivo entails genome instability. Dermal fibroblasts from human female donors aged 20–67 years were studied in primary culture at low population doubling. Under these conditions, the incidence of replicative senescence and rates of age-correlated telomere shortening were insignificant. Genome-wide gene expression analysis revealed age-related impairment of mitosis, telomere and chromosome maintenance and induction of genes associated with DNA repair and non-homologous end-joining, most notably XRCC4 and ligase 4. We observed an age-correlated drop in proliferative capacity and age-correlated increases in heterochromatin marks, structural chromosome abnormalities (deletions, translocations and chromatid breaks), DNA strand breaks and histone H2AX-phosphorylation. In a third of the cells from old and middle-aged donors repair of X-ray induced DNA strand breaks was impaired despite up-regulation of DNA repair genes. The distinct phenotype of genome instability, increased heterochromatinisation and (in 30% of the cases futile) up-regulation of DNA repair genes was stably maintained over several cell passages indicating that it represents a feature of geroconversion that is distinct from cellular senescence, as it does not encompass a block of proliferation. Impact Journals LLC 2015-02-04 /pmc/articles/PMC4359693/ /pubmed/25678531 Text en Copyright: © 2015 Kalfalah et al. http://creativecommons.org/licenses/by/2.5/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
spellingShingle | Research Paper Kalfalah, Faiza Seggewiß, Sabine Walter, Regina Tigges, Julia Moreno-Villanueva, María Bürkle, Alexander Ohse, Sebastian Busch, Hauke Boerries, Melanie Hildebrandt, Barbara Royer-Pokora, Brigitte Boege, Fritz Structural chromosome abnormalities, increased DNA strand breaks and DNA strand break repair deficiency in dermal fibroblasts from old female human donors |
title | Structural chromosome abnormalities, increased DNA strand breaks and DNA strand break repair deficiency in dermal fibroblasts from old female human donors |
title_full | Structural chromosome abnormalities, increased DNA strand breaks and DNA strand break repair deficiency in dermal fibroblasts from old female human donors |
title_fullStr | Structural chromosome abnormalities, increased DNA strand breaks and DNA strand break repair deficiency in dermal fibroblasts from old female human donors |
title_full_unstemmed | Structural chromosome abnormalities, increased DNA strand breaks and DNA strand break repair deficiency in dermal fibroblasts from old female human donors |
title_short | Structural chromosome abnormalities, increased DNA strand breaks and DNA strand break repair deficiency in dermal fibroblasts from old female human donors |
title_sort | structural chromosome abnormalities, increased dna strand breaks and dna strand break repair deficiency in dermal fibroblasts from old female human donors |
topic | Research Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4359693/ https://www.ncbi.nlm.nih.gov/pubmed/25678531 |
work_keys_str_mv | AT kalfalahfaiza structuralchromosomeabnormalitiesincreaseddnastrandbreaksanddnastrandbreakrepairdeficiencyindermalfibroblastsfromoldfemalehumandonors AT seggewißsabine structuralchromosomeabnormalitiesincreaseddnastrandbreaksanddnastrandbreakrepairdeficiencyindermalfibroblastsfromoldfemalehumandonors AT walterregina structuralchromosomeabnormalitiesincreaseddnastrandbreaksanddnastrandbreakrepairdeficiencyindermalfibroblastsfromoldfemalehumandonors AT tiggesjulia structuralchromosomeabnormalitiesincreaseddnastrandbreaksanddnastrandbreakrepairdeficiencyindermalfibroblastsfromoldfemalehumandonors AT morenovillanuevamaria structuralchromosomeabnormalitiesincreaseddnastrandbreaksanddnastrandbreakrepairdeficiencyindermalfibroblastsfromoldfemalehumandonors AT burklealexander structuralchromosomeabnormalitiesincreaseddnastrandbreaksanddnastrandbreakrepairdeficiencyindermalfibroblastsfromoldfemalehumandonors AT ohsesebastian structuralchromosomeabnormalitiesincreaseddnastrandbreaksanddnastrandbreakrepairdeficiencyindermalfibroblastsfromoldfemalehumandonors AT buschhauke structuralchromosomeabnormalitiesincreaseddnastrandbreaksanddnastrandbreakrepairdeficiencyindermalfibroblastsfromoldfemalehumandonors AT boerriesmelanie structuralchromosomeabnormalitiesincreaseddnastrandbreaksanddnastrandbreakrepairdeficiencyindermalfibroblastsfromoldfemalehumandonors AT hildebrandtbarbara structuralchromosomeabnormalitiesincreaseddnastrandbreaksanddnastrandbreakrepairdeficiencyindermalfibroblastsfromoldfemalehumandonors AT royerpokorabrigitte structuralchromosomeabnormalitiesincreaseddnastrandbreaksanddnastrandbreakrepairdeficiencyindermalfibroblastsfromoldfemalehumandonors AT boegefritz structuralchromosomeabnormalitiesincreaseddnastrandbreaksanddnastrandbreakrepairdeficiencyindermalfibroblastsfromoldfemalehumandonors |