Cargando…

Stepwise Catalytic Mechanism via Short-Lived Intermediate Inferred from Combined QM/MM MERP and PES Calculations on Retaining Glycosyltransferase ppGalNAcT2

The glycosylation of cell surface proteins plays a crucial role in a multitude of biological processes, such as cell adhesion and recognition. To understand the process of protein glycosylation, the reaction mechanisms of the participating enzymes need to be known. However, the reaction mechanism of...

Descripción completa

Detalles Bibliográficos
Autores principales: Trnka, Tomáš, Kozmon, Stanislav, Tvaroška, Igor, Koča, Jaroslav
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4388629/
https://www.ncbi.nlm.nih.gov/pubmed/25849117
http://dx.doi.org/10.1371/journal.pcbi.1004061
_version_ 1782365413068242944
author Trnka, Tomáš
Kozmon, Stanislav
Tvaroška, Igor
Koča, Jaroslav
author_facet Trnka, Tomáš
Kozmon, Stanislav
Tvaroška, Igor
Koča, Jaroslav
author_sort Trnka, Tomáš
collection PubMed
description The glycosylation of cell surface proteins plays a crucial role in a multitude of biological processes, such as cell adhesion and recognition. To understand the process of protein glycosylation, the reaction mechanisms of the participating enzymes need to be known. However, the reaction mechanism of retaining glycosyltransferases has not yet been sufficiently explained. Here we investigated the catalytic mechanism of human isoform 2 of the retaining glycosyltransferase polypeptide UDP-GalNAc transferase by coupling two different QM/MM-based approaches, namely a potential energy surface scan in two distance difference dimensions and a minimum energy reaction path optimisation using the Nudged Elastic Band method. Potential energy scan studies often suffer from inadequate sampling of reactive processes due to a predefined scan coordinate system. At the same time, path optimisation methods enable the sampling of a virtually unlimited number of dimensions, but their results cannot be unambiguously interpreted without knowledge of the potential energy surface. By combining these methods, we have been able to eliminate the most significant sources of potential errors inherent to each of these approaches. The structural model is based on the crystal structure of human isoform 2. In the QM/MM method, the QM region consists of 275 atoms, the remaining 5776 atoms were in the MM region. We found that ppGalNAcT2 catalyzes a same-face nucleophilic substitution with internal return (S(N)i). The optimized transition state for the reaction is 13.8 kcal/mol higher in energy than the reactant while the energy of the product complex is 6.7 kcal/mol lower. During the process of nucleophilic attack, a proton is synchronously transferred to the leaving phosphate. The presence of a short-lived metastable oxocarbenium intermediate is likely, as indicated by the reaction energy profiles obtained using high-level density functionals.
format Online
Article
Text
id pubmed-4388629
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-43886292015-04-21 Stepwise Catalytic Mechanism via Short-Lived Intermediate Inferred from Combined QM/MM MERP and PES Calculations on Retaining Glycosyltransferase ppGalNAcT2 Trnka, Tomáš Kozmon, Stanislav Tvaroška, Igor Koča, Jaroslav PLoS Comput Biol Research Article The glycosylation of cell surface proteins plays a crucial role in a multitude of biological processes, such as cell adhesion and recognition. To understand the process of protein glycosylation, the reaction mechanisms of the participating enzymes need to be known. However, the reaction mechanism of retaining glycosyltransferases has not yet been sufficiently explained. Here we investigated the catalytic mechanism of human isoform 2 of the retaining glycosyltransferase polypeptide UDP-GalNAc transferase by coupling two different QM/MM-based approaches, namely a potential energy surface scan in two distance difference dimensions and a minimum energy reaction path optimisation using the Nudged Elastic Band method. Potential energy scan studies often suffer from inadequate sampling of reactive processes due to a predefined scan coordinate system. At the same time, path optimisation methods enable the sampling of a virtually unlimited number of dimensions, but their results cannot be unambiguously interpreted without knowledge of the potential energy surface. By combining these methods, we have been able to eliminate the most significant sources of potential errors inherent to each of these approaches. The structural model is based on the crystal structure of human isoform 2. In the QM/MM method, the QM region consists of 275 atoms, the remaining 5776 atoms were in the MM region. We found that ppGalNAcT2 catalyzes a same-face nucleophilic substitution with internal return (S(N)i). The optimized transition state for the reaction is 13.8 kcal/mol higher in energy than the reactant while the energy of the product complex is 6.7 kcal/mol lower. During the process of nucleophilic attack, a proton is synchronously transferred to the leaving phosphate. The presence of a short-lived metastable oxocarbenium intermediate is likely, as indicated by the reaction energy profiles obtained using high-level density functionals. Public Library of Science 2015-04-07 /pmc/articles/PMC4388629/ /pubmed/25849117 http://dx.doi.org/10.1371/journal.pcbi.1004061 Text en © 2015 Trnka et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited.
spellingShingle Research Article
Trnka, Tomáš
Kozmon, Stanislav
Tvaroška, Igor
Koča, Jaroslav
Stepwise Catalytic Mechanism via Short-Lived Intermediate Inferred from Combined QM/MM MERP and PES Calculations on Retaining Glycosyltransferase ppGalNAcT2
title Stepwise Catalytic Mechanism via Short-Lived Intermediate Inferred from Combined QM/MM MERP and PES Calculations on Retaining Glycosyltransferase ppGalNAcT2
title_full Stepwise Catalytic Mechanism via Short-Lived Intermediate Inferred from Combined QM/MM MERP and PES Calculations on Retaining Glycosyltransferase ppGalNAcT2
title_fullStr Stepwise Catalytic Mechanism via Short-Lived Intermediate Inferred from Combined QM/MM MERP and PES Calculations on Retaining Glycosyltransferase ppGalNAcT2
title_full_unstemmed Stepwise Catalytic Mechanism via Short-Lived Intermediate Inferred from Combined QM/MM MERP and PES Calculations on Retaining Glycosyltransferase ppGalNAcT2
title_short Stepwise Catalytic Mechanism via Short-Lived Intermediate Inferred from Combined QM/MM MERP and PES Calculations on Retaining Glycosyltransferase ppGalNAcT2
title_sort stepwise catalytic mechanism via short-lived intermediate inferred from combined qm/mm merp and pes calculations on retaining glycosyltransferase ppgalnact2
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4388629/
https://www.ncbi.nlm.nih.gov/pubmed/25849117
http://dx.doi.org/10.1371/journal.pcbi.1004061
work_keys_str_mv AT trnkatomas stepwisecatalyticmechanismviashortlivedintermediateinferredfromcombinedqmmmmerpandpescalculationsonretainingglycosyltransferaseppgalnact2
AT kozmonstanislav stepwisecatalyticmechanismviashortlivedintermediateinferredfromcombinedqmmmmerpandpescalculationsonretainingglycosyltransferaseppgalnact2
AT tvaroskaigor stepwisecatalyticmechanismviashortlivedintermediateinferredfromcombinedqmmmmerpandpescalculationsonretainingglycosyltransferaseppgalnact2
AT kocajaroslav stepwisecatalyticmechanismviashortlivedintermediateinferredfromcombinedqmmmmerpandpescalculationsonretainingglycosyltransferaseppgalnact2