Cargando…
Evidence for Posttranslational Protein Flavinylation in the Syphilis Spirochete Treponema pallidum: Structural and Biochemical Insights from the Catalytic Core of a Periplasmic Flavin-Trafficking Protein
The syphilis spirochete Treponema pallidum is an important human pathogen but a highly enigmatic bacterium that cannot be cultivated in vitro. T. pallidum lacks many biosynthetic pathways and therefore has evolved the capability to exploit host-derived metabolites via its periplasmic lipoprotein rep...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
American Society of Microbiology
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4436053/ https://www.ncbi.nlm.nih.gov/pubmed/25944861 http://dx.doi.org/10.1128/mBio.00519-15 |
_version_ | 1782371997065412608 |
---|---|
author | Deka, Ranjit K. Brautigam, Chad A. Liu, Wei Z. Tomchick, Diana R. Norgard, Michael V. |
author_facet | Deka, Ranjit K. Brautigam, Chad A. Liu, Wei Z. Tomchick, Diana R. Norgard, Michael V. |
author_sort | Deka, Ranjit K. |
collection | PubMed |
description | The syphilis spirochete Treponema pallidum is an important human pathogen but a highly enigmatic bacterium that cannot be cultivated in vitro. T. pallidum lacks many biosynthetic pathways and therefore has evolved the capability to exploit host-derived metabolites via its periplasmic lipoprotein repertoire. We recently reported a flavin-trafficking protein in T. pallidum (Ftp_Tp; TP0796) as the first bacterial metal-dependent flavin adenine dinucleotide (FAD) pyrophosphatase that hydrolyzes FAD into AMP and flavin mononucleotide (FMN) in the spirochete’s periplasm. However, orthologs of Ftp_Tp from other bacteria appear to lack this hydrolytic activity; rather, they bind and flavinylate subunits of a cytoplasmic membrane redox system (Nqr/Rnf). To further explore this dichotomy, biochemical analyses, protein crystallography, and structure-based mutagenesis were used to show that a single amino acid change (N55Y) in Ftp_Tp converts it from an Mg(2+)-dependent FAD pyrophosphatase to an FAD-binding protein. We also demonstrated that Ftp_Tp has a second enzymatic activity (Mg(2+)-FMN transferase); it flavinylates protein(s) covalently with FMN on a threonine side chain of an appropriate sequence motif using FAD as the substrate. Moreover, mutation of a metal-binding residue (D284A) eliminates Ftp_Tp’s dual activities, thereby underscoring the role of Mg(2+) in the enzyme-catalyzed reactions. The posttranslational flavinylation activity that can target a periplasmic lipoprotein (TP0171) has not previously been described. The observed activities reveal the catalytic flexibility of a treponemal protein to perform multiple functions. Together, these findings imply mechanisms by which a dynamic pool of flavin cofactor is maintained and how flavoproteins are generated by Ftp_Tp locally in the T. pallidum periplasm. |
format | Online Article Text |
id | pubmed-4436053 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | American Society of Microbiology |
record_format | MEDLINE/PubMed |
spelling | pubmed-44360532015-05-25 Evidence for Posttranslational Protein Flavinylation in the Syphilis Spirochete Treponema pallidum: Structural and Biochemical Insights from the Catalytic Core of a Periplasmic Flavin-Trafficking Protein Deka, Ranjit K. Brautigam, Chad A. Liu, Wei Z. Tomchick, Diana R. Norgard, Michael V. mBio Research Article The syphilis spirochete Treponema pallidum is an important human pathogen but a highly enigmatic bacterium that cannot be cultivated in vitro. T. pallidum lacks many biosynthetic pathways and therefore has evolved the capability to exploit host-derived metabolites via its periplasmic lipoprotein repertoire. We recently reported a flavin-trafficking protein in T. pallidum (Ftp_Tp; TP0796) as the first bacterial metal-dependent flavin adenine dinucleotide (FAD) pyrophosphatase that hydrolyzes FAD into AMP and flavin mononucleotide (FMN) in the spirochete’s periplasm. However, orthologs of Ftp_Tp from other bacteria appear to lack this hydrolytic activity; rather, they bind and flavinylate subunits of a cytoplasmic membrane redox system (Nqr/Rnf). To further explore this dichotomy, biochemical analyses, protein crystallography, and structure-based mutagenesis were used to show that a single amino acid change (N55Y) in Ftp_Tp converts it from an Mg(2+)-dependent FAD pyrophosphatase to an FAD-binding protein. We also demonstrated that Ftp_Tp has a second enzymatic activity (Mg(2+)-FMN transferase); it flavinylates protein(s) covalently with FMN on a threonine side chain of an appropriate sequence motif using FAD as the substrate. Moreover, mutation of a metal-binding residue (D284A) eliminates Ftp_Tp’s dual activities, thereby underscoring the role of Mg(2+) in the enzyme-catalyzed reactions. The posttranslational flavinylation activity that can target a periplasmic lipoprotein (TP0171) has not previously been described. The observed activities reveal the catalytic flexibility of a treponemal protein to perform multiple functions. Together, these findings imply mechanisms by which a dynamic pool of flavin cofactor is maintained and how flavoproteins are generated by Ftp_Tp locally in the T. pallidum periplasm. American Society of Microbiology 2015-05-05 /pmc/articles/PMC4436053/ /pubmed/25944861 http://dx.doi.org/10.1128/mBio.00519-15 Text en Copyright © 2015 Deka et al. http://creativecommons.org/licenses/by-nc-sa/3.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution-Noncommercial-ShareAlike 3.0 Unported license (http://creativecommons.org/licenses/by-nc-sa/3.0/) , which permits unrestricted noncommercial use, distribution, and reproduction in any medium, provided the original author and source are credited. |
spellingShingle | Research Article Deka, Ranjit K. Brautigam, Chad A. Liu, Wei Z. Tomchick, Diana R. Norgard, Michael V. Evidence for Posttranslational Protein Flavinylation in the Syphilis Spirochete Treponema pallidum: Structural and Biochemical Insights from the Catalytic Core of a Periplasmic Flavin-Trafficking Protein |
title | Evidence for Posttranslational Protein Flavinylation in the Syphilis Spirochete Treponema pallidum: Structural and Biochemical Insights from the Catalytic Core of a Periplasmic Flavin-Trafficking Protein |
title_full | Evidence for Posttranslational Protein Flavinylation in the Syphilis Spirochete Treponema pallidum: Structural and Biochemical Insights from the Catalytic Core of a Periplasmic Flavin-Trafficking Protein |
title_fullStr | Evidence for Posttranslational Protein Flavinylation in the Syphilis Spirochete Treponema pallidum: Structural and Biochemical Insights from the Catalytic Core of a Periplasmic Flavin-Trafficking Protein |
title_full_unstemmed | Evidence for Posttranslational Protein Flavinylation in the Syphilis Spirochete Treponema pallidum: Structural and Biochemical Insights from the Catalytic Core of a Periplasmic Flavin-Trafficking Protein |
title_short | Evidence for Posttranslational Protein Flavinylation in the Syphilis Spirochete Treponema pallidum: Structural and Biochemical Insights from the Catalytic Core of a Periplasmic Flavin-Trafficking Protein |
title_sort | evidence for posttranslational protein flavinylation in the syphilis spirochete treponema pallidum: structural and biochemical insights from the catalytic core of a periplasmic flavin-trafficking protein |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4436053/ https://www.ncbi.nlm.nih.gov/pubmed/25944861 http://dx.doi.org/10.1128/mBio.00519-15 |
work_keys_str_mv | AT dekaranjitk evidenceforposttranslationalproteinflavinylationinthesyphilisspirochetetreponemapallidumstructuralandbiochemicalinsightsfromthecatalyticcoreofaperiplasmicflavintraffickingprotein AT brautigamchada evidenceforposttranslationalproteinflavinylationinthesyphilisspirochetetreponemapallidumstructuralandbiochemicalinsightsfromthecatalyticcoreofaperiplasmicflavintraffickingprotein AT liuweiz evidenceforposttranslationalproteinflavinylationinthesyphilisspirochetetreponemapallidumstructuralandbiochemicalinsightsfromthecatalyticcoreofaperiplasmicflavintraffickingprotein AT tomchickdianar evidenceforposttranslationalproteinflavinylationinthesyphilisspirochetetreponemapallidumstructuralandbiochemicalinsightsfromthecatalyticcoreofaperiplasmicflavintraffickingprotein AT norgardmichaelv evidenceforposttranslationalproteinflavinylationinthesyphilisspirochetetreponemapallidumstructuralandbiochemicalinsightsfromthecatalyticcoreofaperiplasmicflavintraffickingprotein |