Cargando…

No up-regulation of the phosphatidylethanolamine N-methyltransferase pathway and choline production by sex hormones in cats

BACKGROUND: Feline hepatic lipidosis (FHL) is a common cholestatic disease affecting cats of any breed, age and sex. Both choline deficiency and low hepatic phosphatidylethanolamine N-methyltransferase (PEMT) activity are associated with hepatic lipidosis (HL) in humans, mice and rats. The PEMT expr...

Descripción completa

Detalles Bibliográficos
Autores principales: Valtolina, Chiara, Vaandrager, Arie B., Favier, Robert P., Robben, Joris H., Tuohetahuntila, Maidina, Kummeling, Anne, Jeusette, Isabelle, Rothuizen, Jan
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4640414/
https://www.ncbi.nlm.nih.gov/pubmed/26552767
http://dx.doi.org/10.1186/s12917-015-0591-6
_version_ 1782400071187300352
author Valtolina, Chiara
Vaandrager, Arie B.
Favier, Robert P.
Robben, Joris H.
Tuohetahuntila, Maidina
Kummeling, Anne
Jeusette, Isabelle
Rothuizen, Jan
author_facet Valtolina, Chiara
Vaandrager, Arie B.
Favier, Robert P.
Robben, Joris H.
Tuohetahuntila, Maidina
Kummeling, Anne
Jeusette, Isabelle
Rothuizen, Jan
author_sort Valtolina, Chiara
collection PubMed
description BACKGROUND: Feline hepatic lipidosis (FHL) is a common cholestatic disease affecting cats of any breed, age and sex. Both choline deficiency and low hepatic phosphatidylethanolamine N-methyltransferase (PEMT) activity are associated with hepatic lipidosis (HL) in humans, mice and rats. The PEMT expression is known to be upregulated by oestrogens, protecting the females in these species from the development of HL when exposed to choline deficient diets. The aim of the present study was to evaluate the influence of sex hormones on choline synthesis via the PEMT pathway in healthy male and female cats before and after spaying/neutering, when fed a diet with recommended dietary choline content. RESULTS: From six female and six male cats PEMT activity was assayed directly in liver biopsies taken before and after spaying/neutering, and assessed indirectly by analyses of PEMT–specific hepatic phosphatidylcholine (PC) species and plasma choline levels. Hepatic PEMT activity did not differ between intact female and male cats and no changes upon spaying/neutering were observed. Likewise, no significant differences in liver PC content and PEMT-specific polyunsaturated PC species were found between the sexes and before or after spaying/neutering. CONCLUSION: These results suggest that choline synthesis in cats differs from what is observed in humans, mice and rats. The lack of evident influence of sex hormones on the PEMT pathway makes it unlikely that spaying/neutering predisposes cats for HL by causing PC deficiency as suggested in other species.
format Online
Article
Text
id pubmed-4640414
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-46404142015-11-11 No up-regulation of the phosphatidylethanolamine N-methyltransferase pathway and choline production by sex hormones in cats Valtolina, Chiara Vaandrager, Arie B. Favier, Robert P. Robben, Joris H. Tuohetahuntila, Maidina Kummeling, Anne Jeusette, Isabelle Rothuizen, Jan BMC Vet Res Research Article BACKGROUND: Feline hepatic lipidosis (FHL) is a common cholestatic disease affecting cats of any breed, age and sex. Both choline deficiency and low hepatic phosphatidylethanolamine N-methyltransferase (PEMT) activity are associated with hepatic lipidosis (HL) in humans, mice and rats. The PEMT expression is known to be upregulated by oestrogens, protecting the females in these species from the development of HL when exposed to choline deficient diets. The aim of the present study was to evaluate the influence of sex hormones on choline synthesis via the PEMT pathway in healthy male and female cats before and after spaying/neutering, when fed a diet with recommended dietary choline content. RESULTS: From six female and six male cats PEMT activity was assayed directly in liver biopsies taken before and after spaying/neutering, and assessed indirectly by analyses of PEMT–specific hepatic phosphatidylcholine (PC) species and plasma choline levels. Hepatic PEMT activity did not differ between intact female and male cats and no changes upon spaying/neutering were observed. Likewise, no significant differences in liver PC content and PEMT-specific polyunsaturated PC species were found between the sexes and before or after spaying/neutering. CONCLUSION: These results suggest that choline synthesis in cats differs from what is observed in humans, mice and rats. The lack of evident influence of sex hormones on the PEMT pathway makes it unlikely that spaying/neutering predisposes cats for HL by causing PC deficiency as suggested in other species. BioMed Central 2015-11-09 /pmc/articles/PMC4640414/ /pubmed/26552767 http://dx.doi.org/10.1186/s12917-015-0591-6 Text en © Valtolina et al. 2015 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Valtolina, Chiara
Vaandrager, Arie B.
Favier, Robert P.
Robben, Joris H.
Tuohetahuntila, Maidina
Kummeling, Anne
Jeusette, Isabelle
Rothuizen, Jan
No up-regulation of the phosphatidylethanolamine N-methyltransferase pathway and choline production by sex hormones in cats
title No up-regulation of the phosphatidylethanolamine N-methyltransferase pathway and choline production by sex hormones in cats
title_full No up-regulation of the phosphatidylethanolamine N-methyltransferase pathway and choline production by sex hormones in cats
title_fullStr No up-regulation of the phosphatidylethanolamine N-methyltransferase pathway and choline production by sex hormones in cats
title_full_unstemmed No up-regulation of the phosphatidylethanolamine N-methyltransferase pathway and choline production by sex hormones in cats
title_short No up-regulation of the phosphatidylethanolamine N-methyltransferase pathway and choline production by sex hormones in cats
title_sort no up-regulation of the phosphatidylethanolamine n-methyltransferase pathway and choline production by sex hormones in cats
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4640414/
https://www.ncbi.nlm.nih.gov/pubmed/26552767
http://dx.doi.org/10.1186/s12917-015-0591-6
work_keys_str_mv AT valtolinachiara noupregulationofthephosphatidylethanolaminenmethyltransferasepathwayandcholineproductionbysexhormonesincats
AT vaandragerarieb noupregulationofthephosphatidylethanolaminenmethyltransferasepathwayandcholineproductionbysexhormonesincats
AT favierrobertp noupregulationofthephosphatidylethanolaminenmethyltransferasepathwayandcholineproductionbysexhormonesincats
AT robbenjorish noupregulationofthephosphatidylethanolaminenmethyltransferasepathwayandcholineproductionbysexhormonesincats
AT tuohetahuntilamaidina noupregulationofthephosphatidylethanolaminenmethyltransferasepathwayandcholineproductionbysexhormonesincats
AT kummelinganne noupregulationofthephosphatidylethanolaminenmethyltransferasepathwayandcholineproductionbysexhormonesincats
AT jeusetteisabelle noupregulationofthephosphatidylethanolaminenmethyltransferasepathwayandcholineproductionbysexhormonesincats
AT rothuizenjan noupregulationofthephosphatidylethanolaminenmethyltransferasepathwayandcholineproductionbysexhormonesincats