Cargando…

CD4 T Cell-Derived IFN-γ Plays a Minimal Role in Control of Pulmonary Mycobacterium tuberculosis Infection and Must Be Actively Repressed by PD-1 to Prevent Lethal Disease

IFN-γ–producing CD4 T cells are required for protection against Mycobacterium tuberculosis (Mtb) infection, but the extent to which IFN-γ contributes to overall CD4 T cell-mediated protection remains unclear. Furthermore, it is not known if increasing IFN-γ production by CD4 T cells is desirable in...

Descripción completa

Detalles Bibliográficos
Autores principales: Sakai, Shunsuke, Kauffman, Keith D., Sallin, Michelle A., Sharpe, Arlene H., Young, Howard A., Ganusov, Vitaly V., Barber, Daniel L.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4887085/
https://www.ncbi.nlm.nih.gov/pubmed/27244558
http://dx.doi.org/10.1371/journal.ppat.1005667
_version_ 1782434695083982848
author Sakai, Shunsuke
Kauffman, Keith D.
Sallin, Michelle A.
Sharpe, Arlene H.
Young, Howard A.
Ganusov, Vitaly V.
Barber, Daniel L.
author_facet Sakai, Shunsuke
Kauffman, Keith D.
Sallin, Michelle A.
Sharpe, Arlene H.
Young, Howard A.
Ganusov, Vitaly V.
Barber, Daniel L.
author_sort Sakai, Shunsuke
collection PubMed
description IFN-γ–producing CD4 T cells are required for protection against Mycobacterium tuberculosis (Mtb) infection, but the extent to which IFN-γ contributes to overall CD4 T cell-mediated protection remains unclear. Furthermore, it is not known if increasing IFN-γ production by CD4 T cells is desirable in Mtb infection. Here we show that IFN-γ accounts for only ~30% of CD4 T cell-dependent cumulative bacterial control in the lungs over the first six weeks of infection, but >80% of control in the spleen. Moreover, increasing the IFN-γ–producing capacity of CD4 T cells by ~2 fold exacerbates lung infection and leads to the early death of the host, despite enhancing control in the spleen. In addition, we show that the inhibitory receptor PD-1 facilitates host resistance to Mtb by preventing the detrimental over-production of IFN-γ by CD4 T cells. Specifically, PD-1 suppressed the parenchymal accumulation of and pathogenic IFN-γ production by the CXCR3(+)KLRG1(-)CX3CR1(-) subset of lung-homing CD4 T cells that otherwise mediates control of Mtb infection. Therefore, the primary role for T cell-derived IFN-γ in Mtb infection is at extra-pulmonary sites, and the host-protective subset of CD4 T cells requires negative regulation of IFN-γ production by PD-1 to prevent lethal immune-mediated pathology.
format Online
Article
Text
id pubmed-4887085
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-48870852016-06-10 CD4 T Cell-Derived IFN-γ Plays a Minimal Role in Control of Pulmonary Mycobacterium tuberculosis Infection and Must Be Actively Repressed by PD-1 to Prevent Lethal Disease Sakai, Shunsuke Kauffman, Keith D. Sallin, Michelle A. Sharpe, Arlene H. Young, Howard A. Ganusov, Vitaly V. Barber, Daniel L. PLoS Pathog Research Article IFN-γ–producing CD4 T cells are required for protection against Mycobacterium tuberculosis (Mtb) infection, but the extent to which IFN-γ contributes to overall CD4 T cell-mediated protection remains unclear. Furthermore, it is not known if increasing IFN-γ production by CD4 T cells is desirable in Mtb infection. Here we show that IFN-γ accounts for only ~30% of CD4 T cell-dependent cumulative bacterial control in the lungs over the first six weeks of infection, but >80% of control in the spleen. Moreover, increasing the IFN-γ–producing capacity of CD4 T cells by ~2 fold exacerbates lung infection and leads to the early death of the host, despite enhancing control in the spleen. In addition, we show that the inhibitory receptor PD-1 facilitates host resistance to Mtb by preventing the detrimental over-production of IFN-γ by CD4 T cells. Specifically, PD-1 suppressed the parenchymal accumulation of and pathogenic IFN-γ production by the CXCR3(+)KLRG1(-)CX3CR1(-) subset of lung-homing CD4 T cells that otherwise mediates control of Mtb infection. Therefore, the primary role for T cell-derived IFN-γ in Mtb infection is at extra-pulmonary sites, and the host-protective subset of CD4 T cells requires negative regulation of IFN-γ production by PD-1 to prevent lethal immune-mediated pathology. Public Library of Science 2016-05-31 /pmc/articles/PMC4887085/ /pubmed/27244558 http://dx.doi.org/10.1371/journal.ppat.1005667 Text en https://creativecommons.org/publicdomain/zero/1.0/ This is an open-access article distributed under the terms of the Creative Commons Public Domain declaration, which stipulates that, once placed in the public domain, this work may be freely reproduced, distributed, transmitted, modified, built upon, or otherwise used by anyone for any lawful purpose.
spellingShingle Research Article
Sakai, Shunsuke
Kauffman, Keith D.
Sallin, Michelle A.
Sharpe, Arlene H.
Young, Howard A.
Ganusov, Vitaly V.
Barber, Daniel L.
CD4 T Cell-Derived IFN-γ Plays a Minimal Role in Control of Pulmonary Mycobacterium tuberculosis Infection and Must Be Actively Repressed by PD-1 to Prevent Lethal Disease
title CD4 T Cell-Derived IFN-γ Plays a Minimal Role in Control of Pulmonary Mycobacterium tuberculosis Infection and Must Be Actively Repressed by PD-1 to Prevent Lethal Disease
title_full CD4 T Cell-Derived IFN-γ Plays a Minimal Role in Control of Pulmonary Mycobacterium tuberculosis Infection and Must Be Actively Repressed by PD-1 to Prevent Lethal Disease
title_fullStr CD4 T Cell-Derived IFN-γ Plays a Minimal Role in Control of Pulmonary Mycobacterium tuberculosis Infection and Must Be Actively Repressed by PD-1 to Prevent Lethal Disease
title_full_unstemmed CD4 T Cell-Derived IFN-γ Plays a Minimal Role in Control of Pulmonary Mycobacterium tuberculosis Infection and Must Be Actively Repressed by PD-1 to Prevent Lethal Disease
title_short CD4 T Cell-Derived IFN-γ Plays a Minimal Role in Control of Pulmonary Mycobacterium tuberculosis Infection and Must Be Actively Repressed by PD-1 to Prevent Lethal Disease
title_sort cd4 t cell-derived ifn-γ plays a minimal role in control of pulmonary mycobacterium tuberculosis infection and must be actively repressed by pd-1 to prevent lethal disease
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4887085/
https://www.ncbi.nlm.nih.gov/pubmed/27244558
http://dx.doi.org/10.1371/journal.ppat.1005667
work_keys_str_mv AT sakaishunsuke cd4tcellderivedifngplaysaminimalroleincontrolofpulmonarymycobacteriumtuberculosisinfectionandmustbeactivelyrepressedbypd1topreventlethaldisease
AT kauffmankeithd cd4tcellderivedifngplaysaminimalroleincontrolofpulmonarymycobacteriumtuberculosisinfectionandmustbeactivelyrepressedbypd1topreventlethaldisease
AT sallinmichellea cd4tcellderivedifngplaysaminimalroleincontrolofpulmonarymycobacteriumtuberculosisinfectionandmustbeactivelyrepressedbypd1topreventlethaldisease
AT sharpearleneh cd4tcellderivedifngplaysaminimalroleincontrolofpulmonarymycobacteriumtuberculosisinfectionandmustbeactivelyrepressedbypd1topreventlethaldisease
AT younghowarda cd4tcellderivedifngplaysaminimalroleincontrolofpulmonarymycobacteriumtuberculosisinfectionandmustbeactivelyrepressedbypd1topreventlethaldisease
AT ganusovvitalyv cd4tcellderivedifngplaysaminimalroleincontrolofpulmonarymycobacteriumtuberculosisinfectionandmustbeactivelyrepressedbypd1topreventlethaldisease
AT barberdaniell cd4tcellderivedifngplaysaminimalroleincontrolofpulmonarymycobacteriumtuberculosisinfectionandmustbeactivelyrepressedbypd1topreventlethaldisease