Cargando…

Aminoglycoside-stimulated readthrough of premature termination codons in selected genes involved in primary ciliary dyskinesia

Translational readthrough of premature termination codons (PTCs) induced by pharmacological compounds has proven to be an effective way of restoring functional protein expression and reducing symptoms in several genetic disorders. We tested the potential of different concentrations of several aminog...

Descripción completa

Detalles Bibliográficos
Autores principales: Bukowy-Bieryllo, Zuzanna, Dabrowski, Maciej, Witt, Michał, Zietkiewicz, Ewa
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Taylor & Francis 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5056772/
https://www.ncbi.nlm.nih.gov/pubmed/27618201
http://dx.doi.org/10.1080/15476286.2016.1219832
_version_ 1782458958213021696
author Bukowy-Bieryllo, Zuzanna
Dabrowski, Maciej
Witt, Michał
Zietkiewicz, Ewa
author_facet Bukowy-Bieryllo, Zuzanna
Dabrowski, Maciej
Witt, Michał
Zietkiewicz, Ewa
author_sort Bukowy-Bieryllo, Zuzanna
collection PubMed
description Translational readthrough of premature termination codons (PTCs) induced by pharmacological compounds has proven to be an effective way of restoring functional protein expression and reducing symptoms in several genetic disorders. We tested the potential of different concentrations of several aminoglycosides (AAGs) for promoting PTC-readthrough in 5 genes involved in the pathogenesis of primary ciliary dyskinesia, an inherited disorder caused by the dysfunction of motile cilia and flagella. The efficiency of readthrough stimulation of PTCs cloned in dual reporter vectors was examined in 2 experimental settings: in vitro (transcription/translation system) and ex vivo (transiently transfected epithelial cell line). PTC-readthrough was observed in 5 of the 16 mutations analyzed. UGA codons were more susceptible to AAG-stimulated readthrough than UAG; no suppression of UAA was observed. The efficiency of PTC-readthrough in vitro (from less than 1% to ∼28% of the translation from the corresponding wild-type constructs) differed with the AAG type and concentration, and depended on the combination of AAG and PTC, indicating that each PTC has to be individually tested with a range of stimulating compounds. The maximal values of PTC suppression observed in the ex vivo experiments were, depending on AAG used, 3–5 times lower than the corresponding values in vitro, despite using AAG concentrations that were 2 orders of magnitude higher. This indicates that, while the in vitro system is sufficient to examine the readthrough-susceptibility of PTCs, it is not sufficient to test the compounds potential to stimulate PTC-readthrough in the living cells. Most of the tested compounds (except for G418) at their highest concentrations did not disturb ciliogenesis in the cultures of primary respiratory epithelial cells from healthy donors.
format Online
Article
Text
id pubmed-5056772
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher Taylor & Francis
record_format MEDLINE/PubMed
spelling pubmed-50567722016-10-18 Aminoglycoside-stimulated readthrough of premature termination codons in selected genes involved in primary ciliary dyskinesia Bukowy-Bieryllo, Zuzanna Dabrowski, Maciej Witt, Michał Zietkiewicz, Ewa RNA Biol Research Paper Translational readthrough of premature termination codons (PTCs) induced by pharmacological compounds has proven to be an effective way of restoring functional protein expression and reducing symptoms in several genetic disorders. We tested the potential of different concentrations of several aminoglycosides (AAGs) for promoting PTC-readthrough in 5 genes involved in the pathogenesis of primary ciliary dyskinesia, an inherited disorder caused by the dysfunction of motile cilia and flagella. The efficiency of readthrough stimulation of PTCs cloned in dual reporter vectors was examined in 2 experimental settings: in vitro (transcription/translation system) and ex vivo (transiently transfected epithelial cell line). PTC-readthrough was observed in 5 of the 16 mutations analyzed. UGA codons were more susceptible to AAG-stimulated readthrough than UAG; no suppression of UAA was observed. The efficiency of PTC-readthrough in vitro (from less than 1% to ∼28% of the translation from the corresponding wild-type constructs) differed with the AAG type and concentration, and depended on the combination of AAG and PTC, indicating that each PTC has to be individually tested with a range of stimulating compounds. The maximal values of PTC suppression observed in the ex vivo experiments were, depending on AAG used, 3–5 times lower than the corresponding values in vitro, despite using AAG concentrations that were 2 orders of magnitude higher. This indicates that, while the in vitro system is sufficient to examine the readthrough-susceptibility of PTCs, it is not sufficient to test the compounds potential to stimulate PTC-readthrough in the living cells. Most of the tested compounds (except for G418) at their highest concentrations did not disturb ciliogenesis in the cultures of primary respiratory epithelial cells from healthy donors. Taylor & Francis 2016-08-12 /pmc/articles/PMC5056772/ /pubmed/27618201 http://dx.doi.org/10.1080/15476286.2016.1219832 Text en © 2016 The Author(s). Published with license by Taylor & Francis Group, LLC http://creativecommons.org/licenses/by-nc/3.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution-Non-Commercial License (http://creativecommons.org/licenses/by-nc/3.0/), which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited. The moral rights of the named author(s) have been asserted.
spellingShingle Research Paper
Bukowy-Bieryllo, Zuzanna
Dabrowski, Maciej
Witt, Michał
Zietkiewicz, Ewa
Aminoglycoside-stimulated readthrough of premature termination codons in selected genes involved in primary ciliary dyskinesia
title Aminoglycoside-stimulated readthrough of premature termination codons in selected genes involved in primary ciliary dyskinesia
title_full Aminoglycoside-stimulated readthrough of premature termination codons in selected genes involved in primary ciliary dyskinesia
title_fullStr Aminoglycoside-stimulated readthrough of premature termination codons in selected genes involved in primary ciliary dyskinesia
title_full_unstemmed Aminoglycoside-stimulated readthrough of premature termination codons in selected genes involved in primary ciliary dyskinesia
title_short Aminoglycoside-stimulated readthrough of premature termination codons in selected genes involved in primary ciliary dyskinesia
title_sort aminoglycoside-stimulated readthrough of premature termination codons in selected genes involved in primary ciliary dyskinesia
topic Research Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5056772/
https://www.ncbi.nlm.nih.gov/pubmed/27618201
http://dx.doi.org/10.1080/15476286.2016.1219832
work_keys_str_mv AT bukowybieryllozuzanna aminoglycosidestimulatedreadthroughofprematureterminationcodonsinselectedgenesinvolvedinprimaryciliarydyskinesia
AT dabrowskimaciej aminoglycosidestimulatedreadthroughofprematureterminationcodonsinselectedgenesinvolvedinprimaryciliarydyskinesia
AT wittmichał aminoglycosidestimulatedreadthroughofprematureterminationcodonsinselectedgenesinvolvedinprimaryciliarydyskinesia
AT zietkiewiczewa aminoglycosidestimulatedreadthroughofprematureterminationcodonsinselectedgenesinvolvedinprimaryciliarydyskinesia