Cargando…

Cell-SELEX Identifies a “Sticky” RNA Aptamer Sequence

Cell-SELEX is performed to select for cell binding aptamers. We employed an additional selection pressure by using RNAse to remove surface-binding aptamers and select for cell-internalizing aptamers. A common RNA sequence was identified from independent cell-SELEX procedures against two different pa...

Descripción completa

Detalles Bibliográficos
Autores principales: Ray, Partha, White, Rebekah R.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Hindawi Publishing Corporation 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5282457/
https://www.ncbi.nlm.nih.gov/pubmed/28194280
http://dx.doi.org/10.1155/2017/4943072
_version_ 1782503325301735424
author Ray, Partha
White, Rebekah R.
author_facet Ray, Partha
White, Rebekah R.
author_sort Ray, Partha
collection PubMed
description Cell-SELEX is performed to select for cell binding aptamers. We employed an additional selection pressure by using RNAse to remove surface-binding aptamers and select for cell-internalizing aptamers. A common RNA sequence was identified from independent cell-SELEX procedures against two different pancreatic cancer cell lines, indicating a strong selection pressure towards this sequence from the large pool of other available sequences present in the aptamer library. The aptamer is not specific for the pancreatic cancer cell lines, and a similar sequence motif is present in previously published internalizing aptamers. The identified sequence forms a structural motif that binds to a surface protein, which either is highly abundant or has strong affinity for the selected aptamer sequence. Deselecting (removing) this sequence during cell-SELEX may increase the probability of identifying aptamers against cell type-specific targets on the cell surface.
format Online
Article
Text
id pubmed-5282457
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Hindawi Publishing Corporation
record_format MEDLINE/PubMed
spelling pubmed-52824572017-02-13 Cell-SELEX Identifies a “Sticky” RNA Aptamer Sequence Ray, Partha White, Rebekah R. J Nucleic Acids Research Article Cell-SELEX is performed to select for cell binding aptamers. We employed an additional selection pressure by using RNAse to remove surface-binding aptamers and select for cell-internalizing aptamers. A common RNA sequence was identified from independent cell-SELEX procedures against two different pancreatic cancer cell lines, indicating a strong selection pressure towards this sequence from the large pool of other available sequences present in the aptamer library. The aptamer is not specific for the pancreatic cancer cell lines, and a similar sequence motif is present in previously published internalizing aptamers. The identified sequence forms a structural motif that binds to a surface protein, which either is highly abundant or has strong affinity for the selected aptamer sequence. Deselecting (removing) this sequence during cell-SELEX may increase the probability of identifying aptamers against cell type-specific targets on the cell surface. Hindawi Publishing Corporation 2017 2017-01-17 /pmc/articles/PMC5282457/ /pubmed/28194280 http://dx.doi.org/10.1155/2017/4943072 Text en Copyright © 2017 P. Ray and R. R. White. https://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Article
Ray, Partha
White, Rebekah R.
Cell-SELEX Identifies a “Sticky” RNA Aptamer Sequence
title Cell-SELEX Identifies a “Sticky” RNA Aptamer Sequence
title_full Cell-SELEX Identifies a “Sticky” RNA Aptamer Sequence
title_fullStr Cell-SELEX Identifies a “Sticky” RNA Aptamer Sequence
title_full_unstemmed Cell-SELEX Identifies a “Sticky” RNA Aptamer Sequence
title_short Cell-SELEX Identifies a “Sticky” RNA Aptamer Sequence
title_sort cell-selex identifies a “sticky” rna aptamer sequence
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5282457/
https://www.ncbi.nlm.nih.gov/pubmed/28194280
http://dx.doi.org/10.1155/2017/4943072
work_keys_str_mv AT raypartha cellselexidentifiesastickyrnaaptamersequence
AT whiterebekahr cellselexidentifiesastickyrnaaptamersequence