Cargando…
Cell-SELEX Identifies a “Sticky” RNA Aptamer Sequence
Cell-SELEX is performed to select for cell binding aptamers. We employed an additional selection pressure by using RNAse to remove surface-binding aptamers and select for cell-internalizing aptamers. A common RNA sequence was identified from independent cell-SELEX procedures against two different pa...
Autores principales: | , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi Publishing Corporation
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5282457/ https://www.ncbi.nlm.nih.gov/pubmed/28194280 http://dx.doi.org/10.1155/2017/4943072 |
_version_ | 1782503325301735424 |
---|---|
author | Ray, Partha White, Rebekah R. |
author_facet | Ray, Partha White, Rebekah R. |
author_sort | Ray, Partha |
collection | PubMed |
description | Cell-SELEX is performed to select for cell binding aptamers. We employed an additional selection pressure by using RNAse to remove surface-binding aptamers and select for cell-internalizing aptamers. A common RNA sequence was identified from independent cell-SELEX procedures against two different pancreatic cancer cell lines, indicating a strong selection pressure towards this sequence from the large pool of other available sequences present in the aptamer library. The aptamer is not specific for the pancreatic cancer cell lines, and a similar sequence motif is present in previously published internalizing aptamers. The identified sequence forms a structural motif that binds to a surface protein, which either is highly abundant or has strong affinity for the selected aptamer sequence. Deselecting (removing) this sequence during cell-SELEX may increase the probability of identifying aptamers against cell type-specific targets on the cell surface. |
format | Online Article Text |
id | pubmed-5282457 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Hindawi Publishing Corporation |
record_format | MEDLINE/PubMed |
spelling | pubmed-52824572017-02-13 Cell-SELEX Identifies a “Sticky” RNA Aptamer Sequence Ray, Partha White, Rebekah R. J Nucleic Acids Research Article Cell-SELEX is performed to select for cell binding aptamers. We employed an additional selection pressure by using RNAse to remove surface-binding aptamers and select for cell-internalizing aptamers. A common RNA sequence was identified from independent cell-SELEX procedures against two different pancreatic cancer cell lines, indicating a strong selection pressure towards this sequence from the large pool of other available sequences present in the aptamer library. The aptamer is not specific for the pancreatic cancer cell lines, and a similar sequence motif is present in previously published internalizing aptamers. The identified sequence forms a structural motif that binds to a surface protein, which either is highly abundant or has strong affinity for the selected aptamer sequence. Deselecting (removing) this sequence during cell-SELEX may increase the probability of identifying aptamers against cell type-specific targets on the cell surface. Hindawi Publishing Corporation 2017 2017-01-17 /pmc/articles/PMC5282457/ /pubmed/28194280 http://dx.doi.org/10.1155/2017/4943072 Text en Copyright © 2017 P. Ray and R. R. White. https://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Ray, Partha White, Rebekah R. Cell-SELEX Identifies a “Sticky” RNA Aptamer Sequence |
title | Cell-SELEX Identifies a “Sticky” RNA Aptamer Sequence |
title_full | Cell-SELEX Identifies a “Sticky” RNA Aptamer Sequence |
title_fullStr | Cell-SELEX Identifies a “Sticky” RNA Aptamer Sequence |
title_full_unstemmed | Cell-SELEX Identifies a “Sticky” RNA Aptamer Sequence |
title_short | Cell-SELEX Identifies a “Sticky” RNA Aptamer Sequence |
title_sort | cell-selex identifies a “sticky” rna aptamer sequence |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5282457/ https://www.ncbi.nlm.nih.gov/pubmed/28194280 http://dx.doi.org/10.1155/2017/4943072 |
work_keys_str_mv | AT raypartha cellselexidentifiesastickyrnaaptamersequence AT whiterebekahr cellselexidentifiesastickyrnaaptamersequence |