Cargando…

Multiple gene variations contributed to congenital heart disease via GATA family transcriptional regulation

BACKGROUND: Congenital heart disease (CHD) is a common birth defect, and most cases occur sporadically. Mutations in key genes that are responsible for cardiac development could contribute to CHD. To date, the genetic causes of CHD remain largely unknown. METHODS: In this study, twenty-nine candidat...

Descripción completa

Detalles Bibliográficos
Autores principales: Qian, Yanyan, Xiao, Deyong, Guo, Xiao, Chen, Hongbo, Hao, Lili, Ma, Xiaojing, Huang, Guoying, Ma, Duan, Wang, Huijun
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5379520/
https://www.ncbi.nlm.nih.gov/pubmed/28372585
http://dx.doi.org/10.1186/s12967-017-1173-0
_version_ 1782519623015464960
author Qian, Yanyan
Xiao, Deyong
Guo, Xiao
Chen, Hongbo
Hao, Lili
Ma, Xiaojing
Huang, Guoying
Ma, Duan
Wang, Huijun
author_facet Qian, Yanyan
Xiao, Deyong
Guo, Xiao
Chen, Hongbo
Hao, Lili
Ma, Xiaojing
Huang, Guoying
Ma, Duan
Wang, Huijun
author_sort Qian, Yanyan
collection PubMed
description BACKGROUND: Congenital heart disease (CHD) is a common birth defect, and most cases occur sporadically. Mutations in key genes that are responsible for cardiac development could contribute to CHD. To date, the genetic causes of CHD remain largely unknown. METHODS: In this study, twenty-nine candidate genes in CHD were sequenced in 106 patients with Tetralogy of Fallot (TOF) using target exome sequencing (TES). The co-immunoprecipitation (CO-IP) and luciferase reporter gene assays were performed in HEK293T cells, and wild-type and mutant mRNA of ZFPM2 were microinjected into zebrafish embryos. RESULTS: Rare variants in key cardiac transcriptional factors and JAG1 were identified in the patients. Four patients carried multiple gene variants. The novel E1148K variant was located at the eighth Zinc-finger domain of FOG2 protein. The CO-IP assays in the HEK293T cells revealed that the variant significantly damaged the interaction between ZFPM2/FOG2 and GATA4. The luciferase reporter gene assays revealed that the E1148K mutant ZFPM2 protein displayed a significantly greater inhibition of the transcriptional activation of GATA4 than the wild-type protein. The wild-type mRNA and the E1148K mutant mRNA of ZFPM2 were injected into zebrafish embryos. At 48 hpf, in the mutant mRNA injection group, the number of embryos with an abnormal cardiac chamber structure and a loss of left–right asymmetry was increased. By 72 hpf, the defects in the chamber and left–right asymmetry became obvious. CONCLUSIONS: We performed TES in sporadic TOF patients and identified rare variants in candidate genes in CHD. We first validated the E1148 K variant in ZFPM2, which is likely involved in the pathogenesis of CHD via GATA4. Moreover, our results suggest that TES could be a useful tool for discovering sequence variants in CHD patients. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12967-017-1173-0) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-5379520
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-53795202017-04-07 Multiple gene variations contributed to congenital heart disease via GATA family transcriptional regulation Qian, Yanyan Xiao, Deyong Guo, Xiao Chen, Hongbo Hao, Lili Ma, Xiaojing Huang, Guoying Ma, Duan Wang, Huijun J Transl Med Research BACKGROUND: Congenital heart disease (CHD) is a common birth defect, and most cases occur sporadically. Mutations in key genes that are responsible for cardiac development could contribute to CHD. To date, the genetic causes of CHD remain largely unknown. METHODS: In this study, twenty-nine candidate genes in CHD were sequenced in 106 patients with Tetralogy of Fallot (TOF) using target exome sequencing (TES). The co-immunoprecipitation (CO-IP) and luciferase reporter gene assays were performed in HEK293T cells, and wild-type and mutant mRNA of ZFPM2 were microinjected into zebrafish embryos. RESULTS: Rare variants in key cardiac transcriptional factors and JAG1 were identified in the patients. Four patients carried multiple gene variants. The novel E1148K variant was located at the eighth Zinc-finger domain of FOG2 protein. The CO-IP assays in the HEK293T cells revealed that the variant significantly damaged the interaction between ZFPM2/FOG2 and GATA4. The luciferase reporter gene assays revealed that the E1148K mutant ZFPM2 protein displayed a significantly greater inhibition of the transcriptional activation of GATA4 than the wild-type protein. The wild-type mRNA and the E1148K mutant mRNA of ZFPM2 were injected into zebrafish embryos. At 48 hpf, in the mutant mRNA injection group, the number of embryos with an abnormal cardiac chamber structure and a loss of left–right asymmetry was increased. By 72 hpf, the defects in the chamber and left–right asymmetry became obvious. CONCLUSIONS: We performed TES in sporadic TOF patients and identified rare variants in candidate genes in CHD. We first validated the E1148 K variant in ZFPM2, which is likely involved in the pathogenesis of CHD via GATA4. Moreover, our results suggest that TES could be a useful tool for discovering sequence variants in CHD patients. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12967-017-1173-0) contains supplementary material, which is available to authorized users. BioMed Central 2017-04-03 /pmc/articles/PMC5379520/ /pubmed/28372585 http://dx.doi.org/10.1186/s12967-017-1173-0 Text en © The Author(s) 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Qian, Yanyan
Xiao, Deyong
Guo, Xiao
Chen, Hongbo
Hao, Lili
Ma, Xiaojing
Huang, Guoying
Ma, Duan
Wang, Huijun
Multiple gene variations contributed to congenital heart disease via GATA family transcriptional regulation
title Multiple gene variations contributed to congenital heart disease via GATA family transcriptional regulation
title_full Multiple gene variations contributed to congenital heart disease via GATA family transcriptional regulation
title_fullStr Multiple gene variations contributed to congenital heart disease via GATA family transcriptional regulation
title_full_unstemmed Multiple gene variations contributed to congenital heart disease via GATA family transcriptional regulation
title_short Multiple gene variations contributed to congenital heart disease via GATA family transcriptional regulation
title_sort multiple gene variations contributed to congenital heart disease via gata family transcriptional regulation
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5379520/
https://www.ncbi.nlm.nih.gov/pubmed/28372585
http://dx.doi.org/10.1186/s12967-017-1173-0
work_keys_str_mv AT qianyanyan multiplegenevariationscontributedtocongenitalheartdiseaseviagatafamilytranscriptionalregulation
AT xiaodeyong multiplegenevariationscontributedtocongenitalheartdiseaseviagatafamilytranscriptionalregulation
AT guoxiao multiplegenevariationscontributedtocongenitalheartdiseaseviagatafamilytranscriptionalregulation
AT chenhongbo multiplegenevariationscontributedtocongenitalheartdiseaseviagatafamilytranscriptionalregulation
AT haolili multiplegenevariationscontributedtocongenitalheartdiseaseviagatafamilytranscriptionalregulation
AT maxiaojing multiplegenevariationscontributedtocongenitalheartdiseaseviagatafamilytranscriptionalregulation
AT huangguoying multiplegenevariationscontributedtocongenitalheartdiseaseviagatafamilytranscriptionalregulation
AT maduan multiplegenevariationscontributedtocongenitalheartdiseaseviagatafamilytranscriptionalregulation
AT wanghuijun multiplegenevariationscontributedtocongenitalheartdiseaseviagatafamilytranscriptionalregulation