Cargando…

PI3K isoform inhibition associated with anti Bcr-Abl drugs shows in vitro increased anti-leukemic activity in Philadelphia chromosome-positive B-acute lymphoblastic leukemia cell lines

B-acute lymphoblastic leukemia (B-ALL) is a malignant disorder characterized by the abnormal proliferation of B-cell progenitors. Philadelphia chromosome-positive (Ph(+)) B-ALL is a subtype that expresses the Bcr-Abl fusion protein which represents a negative prognostic factor. Constitutive activati...

Descripción completa

Detalles Bibliográficos
Autores principales: Ultimo, Simona, Simioni, Carolina, Martelli, Alberto M., Zauli, Giorgio, Evangelisti, Camilla, Celeghini, Claudio, McCubrey, James A., Marisi, Giorgia, Ulivi, Paola, Capitani, Silvano, Neri, Luca M.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Impact Journals LLC 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5410298/
https://www.ncbi.nlm.nih.gov/pubmed/28390196
http://dx.doi.org/10.18632/oncotarget.15542
_version_ 1783232650056564736
author Ultimo, Simona
Simioni, Carolina
Martelli, Alberto M.
Zauli, Giorgio
Evangelisti, Camilla
Celeghini, Claudio
McCubrey, James A.
Marisi, Giorgia
Ulivi, Paola
Capitani, Silvano
Neri, Luca M.
author_facet Ultimo, Simona
Simioni, Carolina
Martelli, Alberto M.
Zauli, Giorgio
Evangelisti, Camilla
Celeghini, Claudio
McCubrey, James A.
Marisi, Giorgia
Ulivi, Paola
Capitani, Silvano
Neri, Luca M.
author_sort Ultimo, Simona
collection PubMed
description B-acute lymphoblastic leukemia (B-ALL) is a malignant disorder characterized by the abnormal proliferation of B-cell progenitors. Philadelphia chromosome-positive (Ph(+)) B-ALL is a subtype that expresses the Bcr-Abl fusion protein which represents a negative prognostic factor. Constitutive activation of the phosphatidylinositol 3-kinase/Akt/mammalian target of rapamycin (PI3K/Akt/mTOR) network is a common feature of B-ALL, influencing cell growth and survival. In the present study, we aimed to investigate the efficacy of PI3K isoform inhibition in B-ALL cell lines harboring the Bcr-Abl fusion protein. We studied the effects of anti Bcr-Abl drugs Imatinib, Nilotinib and GZD824 associated with PI3K isoform inhibitors. We used a panel of six compounds which specifically target PI3K isoforms including the pan-PI3K inhibitor ZSTK474, p110α BYL719 inhibitor and the dual p110γ/p110δ inhibitor IPI145. The effects of single drugs and of several drug combinations were analyzed to assess cytotoxicity by MTS assays, apoptosis and autophagy by flow cytometry and Western blot, as well as the phosphorylation status of the pathway. ZSTK474, BYL719 and IPI145 administered in combination with imatinib, nilotinib and GZD824 for 48 h, decreased cell viability, induced apoptosis and autophagy in a marked synergistic manner. These findings suggest that selected PI3K isoform inhibitors used in combination with anti Bcr-Abl drugs may be an attractive novel therapeutic intervention in Ph(+) B-ALL.
format Online
Article
Text
id pubmed-5410298
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Impact Journals LLC
record_format MEDLINE/PubMed
spelling pubmed-54102982017-05-04 PI3K isoform inhibition associated with anti Bcr-Abl drugs shows in vitro increased anti-leukemic activity in Philadelphia chromosome-positive B-acute lymphoblastic leukemia cell lines Ultimo, Simona Simioni, Carolina Martelli, Alberto M. Zauli, Giorgio Evangelisti, Camilla Celeghini, Claudio McCubrey, James A. Marisi, Giorgia Ulivi, Paola Capitani, Silvano Neri, Luca M. Oncotarget Research Paper B-acute lymphoblastic leukemia (B-ALL) is a malignant disorder characterized by the abnormal proliferation of B-cell progenitors. Philadelphia chromosome-positive (Ph(+)) B-ALL is a subtype that expresses the Bcr-Abl fusion protein which represents a negative prognostic factor. Constitutive activation of the phosphatidylinositol 3-kinase/Akt/mammalian target of rapamycin (PI3K/Akt/mTOR) network is a common feature of B-ALL, influencing cell growth and survival. In the present study, we aimed to investigate the efficacy of PI3K isoform inhibition in B-ALL cell lines harboring the Bcr-Abl fusion protein. We studied the effects of anti Bcr-Abl drugs Imatinib, Nilotinib and GZD824 associated with PI3K isoform inhibitors. We used a panel of six compounds which specifically target PI3K isoforms including the pan-PI3K inhibitor ZSTK474, p110α BYL719 inhibitor and the dual p110γ/p110δ inhibitor IPI145. The effects of single drugs and of several drug combinations were analyzed to assess cytotoxicity by MTS assays, apoptosis and autophagy by flow cytometry and Western blot, as well as the phosphorylation status of the pathway. ZSTK474, BYL719 and IPI145 administered in combination with imatinib, nilotinib and GZD824 for 48 h, decreased cell viability, induced apoptosis and autophagy in a marked synergistic manner. These findings suggest that selected PI3K isoform inhibitors used in combination with anti Bcr-Abl drugs may be an attractive novel therapeutic intervention in Ph(+) B-ALL. Impact Journals LLC 2017-02-20 /pmc/articles/PMC5410298/ /pubmed/28390196 http://dx.doi.org/10.18632/oncotarget.15542 Text en Copyright: © 2017 Ultimo et al. http://creativecommons.org/licenses/by/3.0/ This article is distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/3.0/) (CC-BY), which permits unrestricted use and redistribution provided that the original author and source are credited.
spellingShingle Research Paper
Ultimo, Simona
Simioni, Carolina
Martelli, Alberto M.
Zauli, Giorgio
Evangelisti, Camilla
Celeghini, Claudio
McCubrey, James A.
Marisi, Giorgia
Ulivi, Paola
Capitani, Silvano
Neri, Luca M.
PI3K isoform inhibition associated with anti Bcr-Abl drugs shows in vitro increased anti-leukemic activity in Philadelphia chromosome-positive B-acute lymphoblastic leukemia cell lines
title PI3K isoform inhibition associated with anti Bcr-Abl drugs shows in vitro increased anti-leukemic activity in Philadelphia chromosome-positive B-acute lymphoblastic leukemia cell lines
title_full PI3K isoform inhibition associated with anti Bcr-Abl drugs shows in vitro increased anti-leukemic activity in Philadelphia chromosome-positive B-acute lymphoblastic leukemia cell lines
title_fullStr PI3K isoform inhibition associated with anti Bcr-Abl drugs shows in vitro increased anti-leukemic activity in Philadelphia chromosome-positive B-acute lymphoblastic leukemia cell lines
title_full_unstemmed PI3K isoform inhibition associated with anti Bcr-Abl drugs shows in vitro increased anti-leukemic activity in Philadelphia chromosome-positive B-acute lymphoblastic leukemia cell lines
title_short PI3K isoform inhibition associated with anti Bcr-Abl drugs shows in vitro increased anti-leukemic activity in Philadelphia chromosome-positive B-acute lymphoblastic leukemia cell lines
title_sort pi3k isoform inhibition associated with anti bcr-abl drugs shows in vitro increased anti-leukemic activity in philadelphia chromosome-positive b-acute lymphoblastic leukemia cell lines
topic Research Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5410298/
https://www.ncbi.nlm.nih.gov/pubmed/28390196
http://dx.doi.org/10.18632/oncotarget.15542
work_keys_str_mv AT ultimosimona pi3kisoforminhibitionassociatedwithantibcrabldrugsshowsinvitroincreasedantileukemicactivityinphiladelphiachromosomepositivebacutelymphoblasticleukemiacelllines
AT simionicarolina pi3kisoforminhibitionassociatedwithantibcrabldrugsshowsinvitroincreasedantileukemicactivityinphiladelphiachromosomepositivebacutelymphoblasticleukemiacelllines
AT martellialbertom pi3kisoforminhibitionassociatedwithantibcrabldrugsshowsinvitroincreasedantileukemicactivityinphiladelphiachromosomepositivebacutelymphoblasticleukemiacelllines
AT zauligiorgio pi3kisoforminhibitionassociatedwithantibcrabldrugsshowsinvitroincreasedantileukemicactivityinphiladelphiachromosomepositivebacutelymphoblasticleukemiacelllines
AT evangelisticamilla pi3kisoforminhibitionassociatedwithantibcrabldrugsshowsinvitroincreasedantileukemicactivityinphiladelphiachromosomepositivebacutelymphoblasticleukemiacelllines
AT celeghiniclaudio pi3kisoforminhibitionassociatedwithantibcrabldrugsshowsinvitroincreasedantileukemicactivityinphiladelphiachromosomepositivebacutelymphoblasticleukemiacelllines
AT mccubreyjamesa pi3kisoforminhibitionassociatedwithantibcrabldrugsshowsinvitroincreasedantileukemicactivityinphiladelphiachromosomepositivebacutelymphoblasticleukemiacelllines
AT marisigiorgia pi3kisoforminhibitionassociatedwithantibcrabldrugsshowsinvitroincreasedantileukemicactivityinphiladelphiachromosomepositivebacutelymphoblasticleukemiacelllines
AT ulivipaola pi3kisoforminhibitionassociatedwithantibcrabldrugsshowsinvitroincreasedantileukemicactivityinphiladelphiachromosomepositivebacutelymphoblasticleukemiacelllines
AT capitanisilvano pi3kisoforminhibitionassociatedwithantibcrabldrugsshowsinvitroincreasedantileukemicactivityinphiladelphiachromosomepositivebacutelymphoblasticleukemiacelllines
AT nerilucam pi3kisoforminhibitionassociatedwithantibcrabldrugsshowsinvitroincreasedantileukemicactivityinphiladelphiachromosomepositivebacutelymphoblasticleukemiacelllines