Cargando…
Beneficial effects on host energy metabolism of short-chain fatty acids and vitamins produced by commensal and probiotic bacteria
The aim of this review is to summarize the effect in host energy metabolism of the production of B group vitamins and short chain fatty acids (SCFA) by commensal, food-grade and probiotic bacteria, which are also actors of the mammalian nutrition. The mechanisms of how these microbial end products,...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5423028/ https://www.ncbi.nlm.nih.gov/pubmed/28482838 http://dx.doi.org/10.1186/s12934-017-0691-z |
_version_ | 1783234887152566272 |
---|---|
author | LeBlanc, Jean Guy Chain, Florian Martín, Rebeca Bermúdez-Humarán, Luis G. Courau, Stéphanie Langella, Philippe |
author_facet | LeBlanc, Jean Guy Chain, Florian Martín, Rebeca Bermúdez-Humarán, Luis G. Courau, Stéphanie Langella, Philippe |
author_sort | LeBlanc, Jean Guy |
collection | PubMed |
description | The aim of this review is to summarize the effect in host energy metabolism of the production of B group vitamins and short chain fatty acids (SCFA) by commensal, food-grade and probiotic bacteria, which are also actors of the mammalian nutrition. The mechanisms of how these microbial end products, produced by these bacterial strains, act on energy metabolism will be discussed. We will show that these vitamins and SCFA producing bacteria could be used as tools to recover energy intakes by either optimizing ATP production from foods or by the fermentation of certain fibers in the gastrointestinal tract (GIT). Original data are also presented in this work where SCFA (acetate, butyrate and propionate) and B group vitamins (riboflavin, folate and thiamine) production was determined for selected probiotic bacteria. |
format | Online Article Text |
id | pubmed-5423028 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-54230282017-05-10 Beneficial effects on host energy metabolism of short-chain fatty acids and vitamins produced by commensal and probiotic bacteria LeBlanc, Jean Guy Chain, Florian Martín, Rebeca Bermúdez-Humarán, Luis G. Courau, Stéphanie Langella, Philippe Microb Cell Fact Review The aim of this review is to summarize the effect in host energy metabolism of the production of B group vitamins and short chain fatty acids (SCFA) by commensal, food-grade and probiotic bacteria, which are also actors of the mammalian nutrition. The mechanisms of how these microbial end products, produced by these bacterial strains, act on energy metabolism will be discussed. We will show that these vitamins and SCFA producing bacteria could be used as tools to recover energy intakes by either optimizing ATP production from foods or by the fermentation of certain fibers in the gastrointestinal tract (GIT). Original data are also presented in this work where SCFA (acetate, butyrate and propionate) and B group vitamins (riboflavin, folate and thiamine) production was determined for selected probiotic bacteria. BioMed Central 2017-05-08 /pmc/articles/PMC5423028/ /pubmed/28482838 http://dx.doi.org/10.1186/s12934-017-0691-z Text en © The Author(s) 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Review LeBlanc, Jean Guy Chain, Florian Martín, Rebeca Bermúdez-Humarán, Luis G. Courau, Stéphanie Langella, Philippe Beneficial effects on host energy metabolism of short-chain fatty acids and vitamins produced by commensal and probiotic bacteria |
title | Beneficial effects on host energy metabolism of short-chain fatty acids and vitamins produced by commensal and probiotic bacteria |
title_full | Beneficial effects on host energy metabolism of short-chain fatty acids and vitamins produced by commensal and probiotic bacteria |
title_fullStr | Beneficial effects on host energy metabolism of short-chain fatty acids and vitamins produced by commensal and probiotic bacteria |
title_full_unstemmed | Beneficial effects on host energy metabolism of short-chain fatty acids and vitamins produced by commensal and probiotic bacteria |
title_short | Beneficial effects on host energy metabolism of short-chain fatty acids and vitamins produced by commensal and probiotic bacteria |
title_sort | beneficial effects on host energy metabolism of short-chain fatty acids and vitamins produced by commensal and probiotic bacteria |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5423028/ https://www.ncbi.nlm.nih.gov/pubmed/28482838 http://dx.doi.org/10.1186/s12934-017-0691-z |
work_keys_str_mv | AT leblancjeanguy beneficialeffectsonhostenergymetabolismofshortchainfattyacidsandvitaminsproducedbycommensalandprobioticbacteria AT chainflorian beneficialeffectsonhostenergymetabolismofshortchainfattyacidsandvitaminsproducedbycommensalandprobioticbacteria AT martinrebeca beneficialeffectsonhostenergymetabolismofshortchainfattyacidsandvitaminsproducedbycommensalandprobioticbacteria AT bermudezhumaranluisg beneficialeffectsonhostenergymetabolismofshortchainfattyacidsandvitaminsproducedbycommensalandprobioticbacteria AT couraustephanie beneficialeffectsonhostenergymetabolismofshortchainfattyacidsandvitaminsproducedbycommensalandprobioticbacteria AT langellaphilippe beneficialeffectsonhostenergymetabolismofshortchainfattyacidsandvitaminsproducedbycommensalandprobioticbacteria |