Cargando…

A novel glutaminase inhibitor-968 inhibits the migration and proliferation of non-small cell lung cancer cells by targeting EGFR/ERK signaling pathway

Metabolic reprogramming is critical for cancer cell proliferation. Glutaminolysis which provides cancer cells with bioenergetics and intermediates for macromolecular synthesis have been intensively studied in recent years. Glutaminase C (GAC) is the first and rate-limiting enzyme in glutaminolysis a...

Descripción completa

Detalles Bibliográficos
Autores principales: Han, Tianyu, Guo, Meng, Zhang, Tingting, Gan, Mingxi, Xie, Caifeng, Wang, Jian-Bin
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Impact Journals LLC 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5438631/
https://www.ncbi.nlm.nih.gov/pubmed/28039459
http://dx.doi.org/10.18632/oncotarget.14188
_version_ 1783237806319992832
author Han, Tianyu
Guo, Meng
Zhang, Tingting
Gan, Mingxi
Xie, Caifeng
Wang, Jian-Bin
author_facet Han, Tianyu
Guo, Meng
Zhang, Tingting
Gan, Mingxi
Xie, Caifeng
Wang, Jian-Bin
author_sort Han, Tianyu
collection PubMed
description Metabolic reprogramming is critical for cancer cell proliferation. Glutaminolysis which provides cancer cells with bioenergetics and intermediates for macromolecular synthesis have been intensively studied in recent years. Glutaminase C (GAC) is the first and rate-limiting enzyme in glutaminolysis and plays important roles in cancer initiation and progression. We previously screened a small molecule named 968, a specific inhibitor of GAC, to block the proliferation of human breast cancer cells. In this study, we found that 968 effectively inhibited NSCLC cell proliferation and migration and arrested G0/G1 phase of cell cycle. Furthermore, we demonstrated that 968 inhibited the EGFR/ERK pathway via decreasing the expression of EGFR and phospho-ERK. Apart from this, we discovered that 968 treatment induced autophagy to protect cells against apoptosis and the combination of 968 with autophagy inhibitor Chloroquine (CQ) had synergistic effects on the growth of NSCLC cells. Thus, our study pointed out a new therapeutic strategy for NSCLC treatment by combination of 968 with CQ.
format Online
Article
Text
id pubmed-5438631
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher Impact Journals LLC
record_format MEDLINE/PubMed
spelling pubmed-54386312017-05-24 A novel glutaminase inhibitor-968 inhibits the migration and proliferation of non-small cell lung cancer cells by targeting EGFR/ERK signaling pathway Han, Tianyu Guo, Meng Zhang, Tingting Gan, Mingxi Xie, Caifeng Wang, Jian-Bin Oncotarget Research Paper Metabolic reprogramming is critical for cancer cell proliferation. Glutaminolysis which provides cancer cells with bioenergetics and intermediates for macromolecular synthesis have been intensively studied in recent years. Glutaminase C (GAC) is the first and rate-limiting enzyme in glutaminolysis and plays important roles in cancer initiation and progression. We previously screened a small molecule named 968, a specific inhibitor of GAC, to block the proliferation of human breast cancer cells. In this study, we found that 968 effectively inhibited NSCLC cell proliferation and migration and arrested G0/G1 phase of cell cycle. Furthermore, we demonstrated that 968 inhibited the EGFR/ERK pathway via decreasing the expression of EGFR and phospho-ERK. Apart from this, we discovered that 968 treatment induced autophagy to protect cells against apoptosis and the combination of 968 with autophagy inhibitor Chloroquine (CQ) had synergistic effects on the growth of NSCLC cells. Thus, our study pointed out a new therapeutic strategy for NSCLC treatment by combination of 968 with CQ. Impact Journals LLC 2016-12-26 /pmc/articles/PMC5438631/ /pubmed/28039459 http://dx.doi.org/10.18632/oncotarget.14188 Text en Copyright: © 2017 Han et al. http://creativecommons.org/licenses/by/3.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/3.0/) (CC-BY), which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Research Paper
Han, Tianyu
Guo, Meng
Zhang, Tingting
Gan, Mingxi
Xie, Caifeng
Wang, Jian-Bin
A novel glutaminase inhibitor-968 inhibits the migration and proliferation of non-small cell lung cancer cells by targeting EGFR/ERK signaling pathway
title A novel glutaminase inhibitor-968 inhibits the migration and proliferation of non-small cell lung cancer cells by targeting EGFR/ERK signaling pathway
title_full A novel glutaminase inhibitor-968 inhibits the migration and proliferation of non-small cell lung cancer cells by targeting EGFR/ERK signaling pathway
title_fullStr A novel glutaminase inhibitor-968 inhibits the migration and proliferation of non-small cell lung cancer cells by targeting EGFR/ERK signaling pathway
title_full_unstemmed A novel glutaminase inhibitor-968 inhibits the migration and proliferation of non-small cell lung cancer cells by targeting EGFR/ERK signaling pathway
title_short A novel glutaminase inhibitor-968 inhibits the migration and proliferation of non-small cell lung cancer cells by targeting EGFR/ERK signaling pathway
title_sort novel glutaminase inhibitor-968 inhibits the migration and proliferation of non-small cell lung cancer cells by targeting egfr/erk signaling pathway
topic Research Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5438631/
https://www.ncbi.nlm.nih.gov/pubmed/28039459
http://dx.doi.org/10.18632/oncotarget.14188
work_keys_str_mv AT hantianyu anovelglutaminaseinhibitor968inhibitsthemigrationandproliferationofnonsmallcelllungcancercellsbytargetingegfrerksignalingpathway
AT guomeng anovelglutaminaseinhibitor968inhibitsthemigrationandproliferationofnonsmallcelllungcancercellsbytargetingegfrerksignalingpathway
AT zhangtingting anovelglutaminaseinhibitor968inhibitsthemigrationandproliferationofnonsmallcelllungcancercellsbytargetingegfrerksignalingpathway
AT ganmingxi anovelglutaminaseinhibitor968inhibitsthemigrationandproliferationofnonsmallcelllungcancercellsbytargetingegfrerksignalingpathway
AT xiecaifeng anovelglutaminaseinhibitor968inhibitsthemigrationandproliferationofnonsmallcelllungcancercellsbytargetingegfrerksignalingpathway
AT wangjianbin anovelglutaminaseinhibitor968inhibitsthemigrationandproliferationofnonsmallcelllungcancercellsbytargetingegfrerksignalingpathway
AT hantianyu novelglutaminaseinhibitor968inhibitsthemigrationandproliferationofnonsmallcelllungcancercellsbytargetingegfrerksignalingpathway
AT guomeng novelglutaminaseinhibitor968inhibitsthemigrationandproliferationofnonsmallcelllungcancercellsbytargetingegfrerksignalingpathway
AT zhangtingting novelglutaminaseinhibitor968inhibitsthemigrationandproliferationofnonsmallcelllungcancercellsbytargetingegfrerksignalingpathway
AT ganmingxi novelglutaminaseinhibitor968inhibitsthemigrationandproliferationofnonsmallcelllungcancercellsbytargetingegfrerksignalingpathway
AT xiecaifeng novelglutaminaseinhibitor968inhibitsthemigrationandproliferationofnonsmallcelllungcancercellsbytargetingegfrerksignalingpathway
AT wangjianbin novelglutaminaseinhibitor968inhibitsthemigrationandproliferationofnonsmallcelllungcancercellsbytargetingegfrerksignalingpathway