Cargando…
Spatial cycles mediated by UNC119 solubilisation maintain Src family kinases plasma membrane localisation
The peripheral membrane proto-oncogene Src family protein tyrosine kinases relay growth factor signals to the cytoplasm of mammalian cells. We unravel the spatial cycles of solubilisation, trapping on perinuclear membrane compartments and vesicular transport that counter entropic equilibration to en...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group UK
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5524651/ https://www.ncbi.nlm.nih.gov/pubmed/28740133 http://dx.doi.org/10.1038/s41467-017-00116-3 |
_version_ | 1783252489834856448 |
---|---|
author | Konitsiotis, Antonios D. Roßmannek, Lisaweta Stanoev, Angel Schmick, Malte Bastiaens, Philippe I. H. |
author_facet | Konitsiotis, Antonios D. Roßmannek, Lisaweta Stanoev, Angel Schmick, Malte Bastiaens, Philippe I. H. |
author_sort | Konitsiotis, Antonios D. |
collection | PubMed |
description | The peripheral membrane proto-oncogene Src family protein tyrosine kinases relay growth factor signals to the cytoplasm of mammalian cells. We unravel the spatial cycles of solubilisation, trapping on perinuclear membrane compartments and vesicular transport that counter entropic equilibration to endomembranes for maintaining the enrichment and activity of Src family protein tyrosine kinases at the plasma membrane. The solubilising factor UNC119 sequesters myristoylated Src family protein tyrosine kinases from the cytoplasm, enhancing their diffusion to effectively release Src family protein tyrosine kinases on the recycling endosome by localised Arl2/3 activity. Src is then trapped on the recycling endosome via electrostatic interactions, whereas Fyn is quickly released to be kinetically trapped on the Golgi by palmitoyl acyl-transferase activity. Vesicular trafficking from these compartments restores enrichment of the Src family protein tyrosine kinases to the plasma membrane. Interference with these spatial cycles by UNC119 knockdown disrupts Src family protein tyrosine kinase localisation and signalling activity, indicating that UNC119 could be a drug target to affect oncogenic Src family protein tyrosine kinase signalling. |
format | Online Article Text |
id | pubmed-5524651 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Nature Publishing Group UK |
record_format | MEDLINE/PubMed |
spelling | pubmed-55246512017-07-28 Spatial cycles mediated by UNC119 solubilisation maintain Src family kinases plasma membrane localisation Konitsiotis, Antonios D. Roßmannek, Lisaweta Stanoev, Angel Schmick, Malte Bastiaens, Philippe I. H. Nat Commun Article The peripheral membrane proto-oncogene Src family protein tyrosine kinases relay growth factor signals to the cytoplasm of mammalian cells. We unravel the spatial cycles of solubilisation, trapping on perinuclear membrane compartments and vesicular transport that counter entropic equilibration to endomembranes for maintaining the enrichment and activity of Src family protein tyrosine kinases at the plasma membrane. The solubilising factor UNC119 sequesters myristoylated Src family protein tyrosine kinases from the cytoplasm, enhancing their diffusion to effectively release Src family protein tyrosine kinases on the recycling endosome by localised Arl2/3 activity. Src is then trapped on the recycling endosome via electrostatic interactions, whereas Fyn is quickly released to be kinetically trapped on the Golgi by palmitoyl acyl-transferase activity. Vesicular trafficking from these compartments restores enrichment of the Src family protein tyrosine kinases to the plasma membrane. Interference with these spatial cycles by UNC119 knockdown disrupts Src family protein tyrosine kinase localisation and signalling activity, indicating that UNC119 could be a drug target to affect oncogenic Src family protein tyrosine kinase signalling. Nature Publishing Group UK 2017-07-24 /pmc/articles/PMC5524651/ /pubmed/28740133 http://dx.doi.org/10.1038/s41467-017-00116-3 Text en © The Author(s) 2017 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/. |
spellingShingle | Article Konitsiotis, Antonios D. Roßmannek, Lisaweta Stanoev, Angel Schmick, Malte Bastiaens, Philippe I. H. Spatial cycles mediated by UNC119 solubilisation maintain Src family kinases plasma membrane localisation |
title | Spatial cycles mediated by UNC119 solubilisation maintain Src family kinases plasma membrane localisation |
title_full | Spatial cycles mediated by UNC119 solubilisation maintain Src family kinases plasma membrane localisation |
title_fullStr | Spatial cycles mediated by UNC119 solubilisation maintain Src family kinases plasma membrane localisation |
title_full_unstemmed | Spatial cycles mediated by UNC119 solubilisation maintain Src family kinases plasma membrane localisation |
title_short | Spatial cycles mediated by UNC119 solubilisation maintain Src family kinases plasma membrane localisation |
title_sort | spatial cycles mediated by unc119 solubilisation maintain src family kinases plasma membrane localisation |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5524651/ https://www.ncbi.nlm.nih.gov/pubmed/28740133 http://dx.doi.org/10.1038/s41467-017-00116-3 |
work_keys_str_mv | AT konitsiotisantoniosd spatialcyclesmediatedbyunc119solubilisationmaintainsrcfamilykinasesplasmamembranelocalisation AT roßmanneklisaweta spatialcyclesmediatedbyunc119solubilisationmaintainsrcfamilykinasesplasmamembranelocalisation AT stanoevangel spatialcyclesmediatedbyunc119solubilisationmaintainsrcfamilykinasesplasmamembranelocalisation AT schmickmalte spatialcyclesmediatedbyunc119solubilisationmaintainsrcfamilykinasesplasmamembranelocalisation AT bastiaensphilippeih spatialcyclesmediatedbyunc119solubilisationmaintainsrcfamilykinasesplasmamembranelocalisation |