Cargando…
Plasma trans-fatty acids levels and mortality: a cohort study based on 1999–2000 National Health and Nutrition Examination Survey (NHANES)
BACKGROUND: Trans-fatty acids (TFAs) occur in small amounts in nature but became widely produced by the food industry. The hazardous effects of different TFA subtypes to human health are controversial. We aimed to evaluate the association of plasma TFAs levels (elaidic acid, vaccenic acid, palmitela...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5603045/ https://www.ncbi.nlm.nih.gov/pubmed/28915883 http://dx.doi.org/10.1186/s12944-017-0567-6 |
_version_ | 1783264664405147648 |
---|---|
author | Li, Haibo Zhang, Qian Song, Jiangen Wang, Anshi Zou, Yunfei Ding, Lei Wen, Yufeng |
author_facet | Li, Haibo Zhang, Qian Song, Jiangen Wang, Anshi Zou, Yunfei Ding, Lei Wen, Yufeng |
author_sort | Li, Haibo |
collection | PubMed |
description | BACKGROUND: Trans-fatty acids (TFAs) occur in small amounts in nature but became widely produced by the food industry. The hazardous effects of different TFA subtypes to human health are controversial. We aimed to evaluate the association of plasma TFAs levels (elaidic acid, vaccenic acid, palmitelaidic acid, and linoelaidic acid) with mortality. METHODS: Utilizing 1999–2000 Nutrition Examination Survey (NHANES) and linked mortality data, we performed a cohort study with 1456 participants and used Cox proportional hazards models and penalized smoothing spline plots to elucidate the relationships between TFAs and all-cause, cardiovascular diseases (CVD) and cancer mortality. RESULTS: During 16,034 person-years of follow-up, a total of 221 deaths occurred. In the multivariate model, including mutual adjustment for the 4 TFA subtypes, elaidic acid associated with higher all-cause mortality (hazard ratio (HR) = 2.00, 95% confidence interval (CI) = 1.18 to 3.40, fourth quartiles versus second quartiles) and CVD mortality (HR = 1.64, 95% CI = 1.07 to 2.50, per 10 units increase). Higher palmitelaidic acid levels were associated with increased cancer mortality (HR = 2.91, 95% CI = 1.09 to 7.81, fourth quartiles versus second quartiles). A J-shaped pattern was observed in the regression curve of elaidic acid and all-cause mortality, as well palmitelaidic acid and cancer mortality. CONCLUSIONS: Plasma elaidic acid levels are associated with higher risk of all-cause and CVD mortality, and palmitelaidic acid levels are associated with higher cancer mortality in later life. Further studies are needed to investigate current inconsistent results in this field and the possible underlying mechanisms. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12944-017-0567-6) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5603045 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-56030452017-09-20 Plasma trans-fatty acids levels and mortality: a cohort study based on 1999–2000 National Health and Nutrition Examination Survey (NHANES) Li, Haibo Zhang, Qian Song, Jiangen Wang, Anshi Zou, Yunfei Ding, Lei Wen, Yufeng Lipids Health Dis Research BACKGROUND: Trans-fatty acids (TFAs) occur in small amounts in nature but became widely produced by the food industry. The hazardous effects of different TFA subtypes to human health are controversial. We aimed to evaluate the association of plasma TFAs levels (elaidic acid, vaccenic acid, palmitelaidic acid, and linoelaidic acid) with mortality. METHODS: Utilizing 1999–2000 Nutrition Examination Survey (NHANES) and linked mortality data, we performed a cohort study with 1456 participants and used Cox proportional hazards models and penalized smoothing spline plots to elucidate the relationships between TFAs and all-cause, cardiovascular diseases (CVD) and cancer mortality. RESULTS: During 16,034 person-years of follow-up, a total of 221 deaths occurred. In the multivariate model, including mutual adjustment for the 4 TFA subtypes, elaidic acid associated with higher all-cause mortality (hazard ratio (HR) = 2.00, 95% confidence interval (CI) = 1.18 to 3.40, fourth quartiles versus second quartiles) and CVD mortality (HR = 1.64, 95% CI = 1.07 to 2.50, per 10 units increase). Higher palmitelaidic acid levels were associated with increased cancer mortality (HR = 2.91, 95% CI = 1.09 to 7.81, fourth quartiles versus second quartiles). A J-shaped pattern was observed in the regression curve of elaidic acid and all-cause mortality, as well palmitelaidic acid and cancer mortality. CONCLUSIONS: Plasma elaidic acid levels are associated with higher risk of all-cause and CVD mortality, and palmitelaidic acid levels are associated with higher cancer mortality in later life. Further studies are needed to investigate current inconsistent results in this field and the possible underlying mechanisms. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12944-017-0567-6) contains supplementary material, which is available to authorized users. BioMed Central 2017-09-16 /pmc/articles/PMC5603045/ /pubmed/28915883 http://dx.doi.org/10.1186/s12944-017-0567-6 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Li, Haibo Zhang, Qian Song, Jiangen Wang, Anshi Zou, Yunfei Ding, Lei Wen, Yufeng Plasma trans-fatty acids levels and mortality: a cohort study based on 1999–2000 National Health and Nutrition Examination Survey (NHANES) |
title | Plasma trans-fatty acids levels and mortality: a cohort study based on 1999–2000 National Health and Nutrition Examination Survey (NHANES) |
title_full | Plasma trans-fatty acids levels and mortality: a cohort study based on 1999–2000 National Health and Nutrition Examination Survey (NHANES) |
title_fullStr | Plasma trans-fatty acids levels and mortality: a cohort study based on 1999–2000 National Health and Nutrition Examination Survey (NHANES) |
title_full_unstemmed | Plasma trans-fatty acids levels and mortality: a cohort study based on 1999–2000 National Health and Nutrition Examination Survey (NHANES) |
title_short | Plasma trans-fatty acids levels and mortality: a cohort study based on 1999–2000 National Health and Nutrition Examination Survey (NHANES) |
title_sort | plasma trans-fatty acids levels and mortality: a cohort study based on 1999–2000 national health and nutrition examination survey (nhanes) |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5603045/ https://www.ncbi.nlm.nih.gov/pubmed/28915883 http://dx.doi.org/10.1186/s12944-017-0567-6 |
work_keys_str_mv | AT lihaibo plasmatransfattyacidslevelsandmortalityacohortstudybasedon19992000nationalhealthandnutritionexaminationsurveynhanes AT zhangqian plasmatransfattyacidslevelsandmortalityacohortstudybasedon19992000nationalhealthandnutritionexaminationsurveynhanes AT songjiangen plasmatransfattyacidslevelsandmortalityacohortstudybasedon19992000nationalhealthandnutritionexaminationsurveynhanes AT wanganshi plasmatransfattyacidslevelsandmortalityacohortstudybasedon19992000nationalhealthandnutritionexaminationsurveynhanes AT zouyunfei plasmatransfattyacidslevelsandmortalityacohortstudybasedon19992000nationalhealthandnutritionexaminationsurveynhanes AT dinglei plasmatransfattyacidslevelsandmortalityacohortstudybasedon19992000nationalhealthandnutritionexaminationsurveynhanes AT wenyufeng plasmatransfattyacidslevelsandmortalityacohortstudybasedon19992000nationalhealthandnutritionexaminationsurveynhanes |