Cargando…

GW4064 attenuates lipopolysaccharide-induced hepatic inflammation and apoptosis through inhibition of the Toll-like receptor 4-mediated p38 mitogen-activated protein kinase signaling pathway in mice

Liver injury is associated with devastating consequences caused by inflammation and apoptosis. The farnesoid X receptor (FXR) is a nuclear receptor that has an essential role in hepatoprotection by maintaining the homeostasis of liver metabolism. The present study investigated the capacity of the FX...

Descripción completa

Detalles Bibliográficos
Autores principales: Liu, Hsuan-Miao, Lee, Tzung-Yan, Liao, Jyh-Fei
Formato: Online Artículo Texto
Lenguaje:English
Publicado: D.A. Spandidos 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5819900/
https://www.ncbi.nlm.nih.gov/pubmed/29328388
http://dx.doi.org/10.3892/ijmm.2018.3366
_version_ 1783301283118055424
author Liu, Hsuan-Miao
Lee, Tzung-Yan
Liao, Jyh-Fei
author_facet Liu, Hsuan-Miao
Lee, Tzung-Yan
Liao, Jyh-Fei
author_sort Liu, Hsuan-Miao
collection PubMed
description Liver injury is associated with devastating consequences caused by inflammation and apoptosis. The farnesoid X receptor (FXR) is a nuclear receptor that has an essential role in hepatoprotection by maintaining the homeostasis of liver metabolism. The present study investigated the capacity of the FXR agonist GW4064 to protect the livers of mice from lipo-polysaccharide (LPS)-induced inflammation and apoptosis. Male C57BL/6J [wild-type (WT)] and FXR knockout (KO) mice were intraperitoneally injected with LPS or saline. LPS-treated mice were intraperitoneally injected with vehicle or GW4064 (20 mg/kg) twice and then sacrificed. Activation of FXR by GW4064 alleviated hepatic inflammation in the LPS-induced murine liver injury model as reflected by reduced serum levels of aspartate aminotransferase and pro-inflammatory cytokine mRNA expression, including tumor necrosis factor-α, as well as interleukin-6 and -1β in WT mice. In addition, Toll-like receptor 4 (TLR4), p38 mitogen-activated protein kinase (MAPK), B-cell lymphoma-2-associated X protein and cytochrome c protein levels were decreased in WT mice receiving LPS with simultaneous GW4064 administration compared with those receiving LPS alone, while this was not observed in FXR KO mice. These results indicated that in WT mice, administration of GW4064 ameliorated LPS-mediated liver injury by upregulation of FXR expression, which was in part mediated by the TLR4/p38 MAPK pathway.
format Online
Article
Text
id pubmed-5819900
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher D.A. Spandidos
record_format MEDLINE/PubMed
spelling pubmed-58199002018-03-02 GW4064 attenuates lipopolysaccharide-induced hepatic inflammation and apoptosis through inhibition of the Toll-like receptor 4-mediated p38 mitogen-activated protein kinase signaling pathway in mice Liu, Hsuan-Miao Lee, Tzung-Yan Liao, Jyh-Fei Int J Mol Med Articles Liver injury is associated with devastating consequences caused by inflammation and apoptosis. The farnesoid X receptor (FXR) is a nuclear receptor that has an essential role in hepatoprotection by maintaining the homeostasis of liver metabolism. The present study investigated the capacity of the FXR agonist GW4064 to protect the livers of mice from lipo-polysaccharide (LPS)-induced inflammation and apoptosis. Male C57BL/6J [wild-type (WT)] and FXR knockout (KO) mice were intraperitoneally injected with LPS or saline. LPS-treated mice were intraperitoneally injected with vehicle or GW4064 (20 mg/kg) twice and then sacrificed. Activation of FXR by GW4064 alleviated hepatic inflammation in the LPS-induced murine liver injury model as reflected by reduced serum levels of aspartate aminotransferase and pro-inflammatory cytokine mRNA expression, including tumor necrosis factor-α, as well as interleukin-6 and -1β in WT mice. In addition, Toll-like receptor 4 (TLR4), p38 mitogen-activated protein kinase (MAPK), B-cell lymphoma-2-associated X protein and cytochrome c protein levels were decreased in WT mice receiving LPS with simultaneous GW4064 administration compared with those receiving LPS alone, while this was not observed in FXR KO mice. These results indicated that in WT mice, administration of GW4064 ameliorated LPS-mediated liver injury by upregulation of FXR expression, which was in part mediated by the TLR4/p38 MAPK pathway. D.A. Spandidos 2018-03 2018-01-08 /pmc/articles/PMC5819900/ /pubmed/29328388 http://dx.doi.org/10.3892/ijmm.2018.3366 Text en Copyright: © Liu et al. This is an open access article distributed under the terms of the Creative Commons Attribution-NonCommercial-NoDerivs License (https://creativecommons.org/licenses/by-nc-nd/4.0/) , which permits use and distribution in any medium, provided the original work is properly cited, the use is non-commercial and no modifications or adaptations are made.
spellingShingle Articles
Liu, Hsuan-Miao
Lee, Tzung-Yan
Liao, Jyh-Fei
GW4064 attenuates lipopolysaccharide-induced hepatic inflammation and apoptosis through inhibition of the Toll-like receptor 4-mediated p38 mitogen-activated protein kinase signaling pathway in mice
title GW4064 attenuates lipopolysaccharide-induced hepatic inflammation and apoptosis through inhibition of the Toll-like receptor 4-mediated p38 mitogen-activated protein kinase signaling pathway in mice
title_full GW4064 attenuates lipopolysaccharide-induced hepatic inflammation and apoptosis through inhibition of the Toll-like receptor 4-mediated p38 mitogen-activated protein kinase signaling pathway in mice
title_fullStr GW4064 attenuates lipopolysaccharide-induced hepatic inflammation and apoptosis through inhibition of the Toll-like receptor 4-mediated p38 mitogen-activated protein kinase signaling pathway in mice
title_full_unstemmed GW4064 attenuates lipopolysaccharide-induced hepatic inflammation and apoptosis through inhibition of the Toll-like receptor 4-mediated p38 mitogen-activated protein kinase signaling pathway in mice
title_short GW4064 attenuates lipopolysaccharide-induced hepatic inflammation and apoptosis through inhibition of the Toll-like receptor 4-mediated p38 mitogen-activated protein kinase signaling pathway in mice
title_sort gw4064 attenuates lipopolysaccharide-induced hepatic inflammation and apoptosis through inhibition of the toll-like receptor 4-mediated p38 mitogen-activated protein kinase signaling pathway in mice
topic Articles
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5819900/
https://www.ncbi.nlm.nih.gov/pubmed/29328388
http://dx.doi.org/10.3892/ijmm.2018.3366
work_keys_str_mv AT liuhsuanmiao gw4064attenuateslipopolysaccharideinducedhepaticinflammationandapoptosisthroughinhibitionofthetolllikereceptor4mediatedp38mitogenactivatedproteinkinasesignalingpathwayinmice
AT leetzungyan gw4064attenuateslipopolysaccharideinducedhepaticinflammationandapoptosisthroughinhibitionofthetolllikereceptor4mediatedp38mitogenactivatedproteinkinasesignalingpathwayinmice
AT liaojyhfei gw4064attenuateslipopolysaccharideinducedhepaticinflammationandapoptosisthroughinhibitionofthetolllikereceptor4mediatedp38mitogenactivatedproteinkinasesignalingpathwayinmice