Cargando…
Whey protein lowers systolic blood pressure and Ca-caseinate reduces serum TAG after a high-fat meal in mildly hypertensive adults
Epidemiological studies show an inverse association between dairy consumption and blood pressure (BP) but there are few data on the postprandial effects of milk proteins. This study examined their effects, compared to maltodextrin, on postprandial BP and other CVD risk markers in volunteers with mil...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group UK
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5864936/ https://www.ncbi.nlm.nih.gov/pubmed/29568003 http://dx.doi.org/10.1038/s41598-018-23333-2 |
_version_ | 1783308589834698752 |
---|---|
author | Fekete, Ágnes A. Giromini, Carlotta Chatzidiakou, Yianna Givens, D. Ian Lovegrove, Julie A. |
author_facet | Fekete, Ágnes A. Giromini, Carlotta Chatzidiakou, Yianna Givens, D. Ian Lovegrove, Julie A. |
author_sort | Fekete, Ágnes A. |
collection | PubMed |
description | Epidemiological studies show an inverse association between dairy consumption and blood pressure (BP) but there are few data on the postprandial effects of milk proteins. This study examined their effects, compared to maltodextrin, on postprandial BP and other CVD risk markers in volunteers with mild and pre-hypertension over an 8 h period. In this double-blinded, randomised, cross-over, controlled study 27 adults ingested a high-fat, isoenergetic breakfast and lunch with 28 g whey protein, 28 g Ca-caseinate or 27 g maltodextrin. Whey protein reduced systolic BP compared with Ca-caseinate (−15.2 ± 13.6 mmHg) and maltodextrin (−23.4 ± 10.5 mmHg) up to 5 h post-ingestion. There was an improvement in arterial stiffness after whey protein compared with maltodextrin (incremental Area Under the Curve- iAUC(0–8h): +14.4 ± 6.2%). Despite similar glucose levels after both whey protein and Ca-caseinate, whey protein induced a higher insulin response than Ca-caseinate (iAUC(0–8h): +219.5 ± 54.6 pmol/L). Ca-caseinate induced less suppression of non-esterified fatty acids than whey protein (iAUC(0–5h): −58.9 ± 135.5 μmol/L) and maltodextrin (iAUC(0–5h): −106.9 ± 89.4 μmol/L) and induced a smaller postprandial triacylglycerol response than whey protein (iAUC(0–8h): −1.68 ± 0.6 mmol/L). Milk proteins co-ingestion with high-fat meals may have the potential to maintain or improve CVD risk factors. |
format | Online Article Text |
id | pubmed-5864936 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | Nature Publishing Group UK |
record_format | MEDLINE/PubMed |
spelling | pubmed-58649362018-03-27 Whey protein lowers systolic blood pressure and Ca-caseinate reduces serum TAG after a high-fat meal in mildly hypertensive adults Fekete, Ágnes A. Giromini, Carlotta Chatzidiakou, Yianna Givens, D. Ian Lovegrove, Julie A. Sci Rep Article Epidemiological studies show an inverse association between dairy consumption and blood pressure (BP) but there are few data on the postprandial effects of milk proteins. This study examined their effects, compared to maltodextrin, on postprandial BP and other CVD risk markers in volunteers with mild and pre-hypertension over an 8 h period. In this double-blinded, randomised, cross-over, controlled study 27 adults ingested a high-fat, isoenergetic breakfast and lunch with 28 g whey protein, 28 g Ca-caseinate or 27 g maltodextrin. Whey protein reduced systolic BP compared with Ca-caseinate (−15.2 ± 13.6 mmHg) and maltodextrin (−23.4 ± 10.5 mmHg) up to 5 h post-ingestion. There was an improvement in arterial stiffness after whey protein compared with maltodextrin (incremental Area Under the Curve- iAUC(0–8h): +14.4 ± 6.2%). Despite similar glucose levels after both whey protein and Ca-caseinate, whey protein induced a higher insulin response than Ca-caseinate (iAUC(0–8h): +219.5 ± 54.6 pmol/L). Ca-caseinate induced less suppression of non-esterified fatty acids than whey protein (iAUC(0–5h): −58.9 ± 135.5 μmol/L) and maltodextrin (iAUC(0–5h): −106.9 ± 89.4 μmol/L) and induced a smaller postprandial triacylglycerol response than whey protein (iAUC(0–8h): −1.68 ± 0.6 mmol/L). Milk proteins co-ingestion with high-fat meals may have the potential to maintain or improve CVD risk factors. Nature Publishing Group UK 2018-03-22 /pmc/articles/PMC5864936/ /pubmed/29568003 http://dx.doi.org/10.1038/s41598-018-23333-2 Text en © The Author(s) 2018 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/. |
spellingShingle | Article Fekete, Ágnes A. Giromini, Carlotta Chatzidiakou, Yianna Givens, D. Ian Lovegrove, Julie A. Whey protein lowers systolic blood pressure and Ca-caseinate reduces serum TAG after a high-fat meal in mildly hypertensive adults |
title | Whey protein lowers systolic blood pressure and Ca-caseinate reduces serum TAG after a high-fat meal in mildly hypertensive adults |
title_full | Whey protein lowers systolic blood pressure and Ca-caseinate reduces serum TAG after a high-fat meal in mildly hypertensive adults |
title_fullStr | Whey protein lowers systolic blood pressure and Ca-caseinate reduces serum TAG after a high-fat meal in mildly hypertensive adults |
title_full_unstemmed | Whey protein lowers systolic blood pressure and Ca-caseinate reduces serum TAG after a high-fat meal in mildly hypertensive adults |
title_short | Whey protein lowers systolic blood pressure and Ca-caseinate reduces serum TAG after a high-fat meal in mildly hypertensive adults |
title_sort | whey protein lowers systolic blood pressure and ca-caseinate reduces serum tag after a high-fat meal in mildly hypertensive adults |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5864936/ https://www.ncbi.nlm.nih.gov/pubmed/29568003 http://dx.doi.org/10.1038/s41598-018-23333-2 |
work_keys_str_mv | AT feketeagnesa wheyproteinlowerssystolicbloodpressureandcacaseinatereducesserumtagafterahighfatmealinmildlyhypertensiveadults AT girominicarlotta wheyproteinlowerssystolicbloodpressureandcacaseinatereducesserumtagafterahighfatmealinmildlyhypertensiveadults AT chatzidiakouyianna wheyproteinlowerssystolicbloodpressureandcacaseinatereducesserumtagafterahighfatmealinmildlyhypertensiveadults AT givensdian wheyproteinlowerssystolicbloodpressureandcacaseinatereducesserumtagafterahighfatmealinmildlyhypertensiveadults AT lovegrovejuliea wheyproteinlowerssystolicbloodpressureandcacaseinatereducesserumtagafterahighfatmealinmildlyhypertensiveadults |