Cargando…
Human bone marrow-derived mesenchymal stem cells promote the growth and drug-resistance of diffuse large B-cell lymphoma by secreting IL-6 and elevating IL-17A levels
BACKGROUND: The drug-resistance and relapse of diffuse large B-cell lymphoma (DLBCL), which are related to mesenchymal stem cells (MSCs), have become increasingly common. However, the underlying mechanisms remain elusive. METHODS: CCK 8 assay, colony formation assay, and xenograft mouse model were u...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6373150/ https://www.ncbi.nlm.nih.gov/pubmed/30755239 http://dx.doi.org/10.1186/s13046-019-1081-7 |
_version_ | 1783394917390745600 |
---|---|
author | Zhong, Weijie Zhu, Zhigang Xu, Xin Zhang, Hui Xiong, Huabao Li, Qingshan Wei, Yaming |
author_facet | Zhong, Weijie Zhu, Zhigang Xu, Xin Zhang, Hui Xiong, Huabao Li, Qingshan Wei, Yaming |
author_sort | Zhong, Weijie |
collection | PubMed |
description | BACKGROUND: The drug-resistance and relapse of diffuse large B-cell lymphoma (DLBCL), which are related to mesenchymal stem cells (MSCs), have become increasingly common. However, the underlying mechanisms remain elusive. METHODS: CCK 8 assay, colony formation assay, and xenograft mouse model were used to investigate the effects of hBMSCs on DLBCL growth. Immunohistochemistry, qRT-PCR, and ELISA were used to study the expressions of IL-6 and IL-17A. Flow cytometry was used to analyze Th17 cells and Treg cells expressions. Western blot analysis, microarray analysis, and bioinformatics analysis were used to analyze the pathways of IL-6 or IL-17A mediated DLBCL growth. RESULTS: HBMSCs promoted DLBCL growth by secreting IL-6 in vitro and in vivo and simultaneously upregulating IL-17A in vitro. IL-6 and IL-17A synergistically promoted the growth and drug-resistance of DLBCL cells by protecting them from spontaneous or drug-induced apoptosis in vitro. IL-6 or IL-17A activated the JAK2/STAT3 pathway or upregulated cyclin D2 via activation of PI3K/Akt signaling in vitro, respectively. CONCLUSIONS: The present results indicated that hBMSCs might have a “dual effect” on promoting DLBCL progression and drug-resistance by secreting IL-6 and upregulating IL-17A. IL-6, IL-17A, p-STAT3, p-Akt or cyclin D2 may be potential molecular targets for overcoming drug-resistance in patients with relapsed or refractory DLBCL. |
format | Online Article Text |
id | pubmed-6373150 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-63731502019-02-25 Human bone marrow-derived mesenchymal stem cells promote the growth and drug-resistance of diffuse large B-cell lymphoma by secreting IL-6 and elevating IL-17A levels Zhong, Weijie Zhu, Zhigang Xu, Xin Zhang, Hui Xiong, Huabao Li, Qingshan Wei, Yaming J Exp Clin Cancer Res Research BACKGROUND: The drug-resistance and relapse of diffuse large B-cell lymphoma (DLBCL), which are related to mesenchymal stem cells (MSCs), have become increasingly common. However, the underlying mechanisms remain elusive. METHODS: CCK 8 assay, colony formation assay, and xenograft mouse model were used to investigate the effects of hBMSCs on DLBCL growth. Immunohistochemistry, qRT-PCR, and ELISA were used to study the expressions of IL-6 and IL-17A. Flow cytometry was used to analyze Th17 cells and Treg cells expressions. Western blot analysis, microarray analysis, and bioinformatics analysis were used to analyze the pathways of IL-6 or IL-17A mediated DLBCL growth. RESULTS: HBMSCs promoted DLBCL growth by secreting IL-6 in vitro and in vivo and simultaneously upregulating IL-17A in vitro. IL-6 and IL-17A synergistically promoted the growth and drug-resistance of DLBCL cells by protecting them from spontaneous or drug-induced apoptosis in vitro. IL-6 or IL-17A activated the JAK2/STAT3 pathway or upregulated cyclin D2 via activation of PI3K/Akt signaling in vitro, respectively. CONCLUSIONS: The present results indicated that hBMSCs might have a “dual effect” on promoting DLBCL progression and drug-resistance by secreting IL-6 and upregulating IL-17A. IL-6, IL-17A, p-STAT3, p-Akt or cyclin D2 may be potential molecular targets for overcoming drug-resistance in patients with relapsed or refractory DLBCL. BioMed Central 2019-02-12 /pmc/articles/PMC6373150/ /pubmed/30755239 http://dx.doi.org/10.1186/s13046-019-1081-7 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Zhong, Weijie Zhu, Zhigang Xu, Xin Zhang, Hui Xiong, Huabao Li, Qingshan Wei, Yaming Human bone marrow-derived mesenchymal stem cells promote the growth and drug-resistance of diffuse large B-cell lymphoma by secreting IL-6 and elevating IL-17A levels |
title | Human bone marrow-derived mesenchymal stem cells promote the growth and drug-resistance of diffuse large B-cell lymphoma by secreting IL-6 and elevating IL-17A levels |
title_full | Human bone marrow-derived mesenchymal stem cells promote the growth and drug-resistance of diffuse large B-cell lymphoma by secreting IL-6 and elevating IL-17A levels |
title_fullStr | Human bone marrow-derived mesenchymal stem cells promote the growth and drug-resistance of diffuse large B-cell lymphoma by secreting IL-6 and elevating IL-17A levels |
title_full_unstemmed | Human bone marrow-derived mesenchymal stem cells promote the growth and drug-resistance of diffuse large B-cell lymphoma by secreting IL-6 and elevating IL-17A levels |
title_short | Human bone marrow-derived mesenchymal stem cells promote the growth and drug-resistance of diffuse large B-cell lymphoma by secreting IL-6 and elevating IL-17A levels |
title_sort | human bone marrow-derived mesenchymal stem cells promote the growth and drug-resistance of diffuse large b-cell lymphoma by secreting il-6 and elevating il-17a levels |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6373150/ https://www.ncbi.nlm.nih.gov/pubmed/30755239 http://dx.doi.org/10.1186/s13046-019-1081-7 |
work_keys_str_mv | AT zhongweijie humanbonemarrowderivedmesenchymalstemcellspromotethegrowthanddrugresistanceofdiffuselargebcelllymphomabysecretingil6andelevatingil17alevels AT zhuzhigang humanbonemarrowderivedmesenchymalstemcellspromotethegrowthanddrugresistanceofdiffuselargebcelllymphomabysecretingil6andelevatingil17alevels AT xuxin humanbonemarrowderivedmesenchymalstemcellspromotethegrowthanddrugresistanceofdiffuselargebcelllymphomabysecretingil6andelevatingil17alevels AT zhanghui humanbonemarrowderivedmesenchymalstemcellspromotethegrowthanddrugresistanceofdiffuselargebcelllymphomabysecretingil6andelevatingil17alevels AT xionghuabao humanbonemarrowderivedmesenchymalstemcellspromotethegrowthanddrugresistanceofdiffuselargebcelllymphomabysecretingil6andelevatingil17alevels AT liqingshan humanbonemarrowderivedmesenchymalstemcellspromotethegrowthanddrugresistanceofdiffuselargebcelllymphomabysecretingil6andelevatingil17alevels AT weiyaming humanbonemarrowderivedmesenchymalstemcellspromotethegrowthanddrugresistanceofdiffuselargebcelllymphomabysecretingil6andelevatingil17alevels |