Cargando…

Lipid–Protein Interactions in Niemann–Pick Type C Disease: Insights from Molecular Modeling

The accumulation of lipids in the late endosomes and lysosomes of Niemann–Pick type C disease (NPCD) cells is a consequence of the dysfunction of one protein (usually NPC1) but induces dysfunction in many proteins. We used molecular docking to propose (a) that NPC1 exports not just cholesterol, but...

Descripción completa

Detalles Bibliográficos
Autores principales: Wheeler, Simon, Schmid, Ralf, Sillence, Dan J
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6387118/
https://www.ncbi.nlm.nih.gov/pubmed/30736449
http://dx.doi.org/10.3390/ijms20030717
_version_ 1783397499841544192
author Wheeler, Simon
Schmid, Ralf
Sillence, Dan J
author_facet Wheeler, Simon
Schmid, Ralf
Sillence, Dan J
author_sort Wheeler, Simon
collection PubMed
description The accumulation of lipids in the late endosomes and lysosomes of Niemann–Pick type C disease (NPCD) cells is a consequence of the dysfunction of one protein (usually NPC1) but induces dysfunction in many proteins. We used molecular docking to propose (a) that NPC1 exports not just cholesterol, but also sphingosine, (b) that the cholesterol sensitivity of big potassium channel (BK) can be traced to a previously unappreciated site on the channel’s voltage sensor, (c) that transient receptor potential mucolipin 1 (TRPML1) inhibition by sphingomyelin is likely an indirect effect, and (d) that phosphoinositides are responsible for both the mislocalization of annexin A2 (AnxA2) and a soluble NSF (N-ethylmaleimide Sensitive Fusion) protein attachment receptor (SNARE) recycling defect. These results are set in the context of existing knowledge of NPCD to sketch an account of the endolysosomal pathology key to this disease.
format Online
Article
Text
id pubmed-6387118
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-63871182019-02-27 Lipid–Protein Interactions in Niemann–Pick Type C Disease: Insights from Molecular Modeling Wheeler, Simon Schmid, Ralf Sillence, Dan J Int J Mol Sci Article The accumulation of lipids in the late endosomes and lysosomes of Niemann–Pick type C disease (NPCD) cells is a consequence of the dysfunction of one protein (usually NPC1) but induces dysfunction in many proteins. We used molecular docking to propose (a) that NPC1 exports not just cholesterol, but also sphingosine, (b) that the cholesterol sensitivity of big potassium channel (BK) can be traced to a previously unappreciated site on the channel’s voltage sensor, (c) that transient receptor potential mucolipin 1 (TRPML1) inhibition by sphingomyelin is likely an indirect effect, and (d) that phosphoinositides are responsible for both the mislocalization of annexin A2 (AnxA2) and a soluble NSF (N-ethylmaleimide Sensitive Fusion) protein attachment receptor (SNARE) recycling defect. These results are set in the context of existing knowledge of NPCD to sketch an account of the endolysosomal pathology key to this disease. MDPI 2019-02-07 /pmc/articles/PMC6387118/ /pubmed/30736449 http://dx.doi.org/10.3390/ijms20030717 Text en © 2019 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Wheeler, Simon
Schmid, Ralf
Sillence, Dan J
Lipid–Protein Interactions in Niemann–Pick Type C Disease: Insights from Molecular Modeling
title Lipid–Protein Interactions in Niemann–Pick Type C Disease: Insights from Molecular Modeling
title_full Lipid–Protein Interactions in Niemann–Pick Type C Disease: Insights from Molecular Modeling
title_fullStr Lipid–Protein Interactions in Niemann–Pick Type C Disease: Insights from Molecular Modeling
title_full_unstemmed Lipid–Protein Interactions in Niemann–Pick Type C Disease: Insights from Molecular Modeling
title_short Lipid–Protein Interactions in Niemann–Pick Type C Disease: Insights from Molecular Modeling
title_sort lipid–protein interactions in niemann–pick type c disease: insights from molecular modeling
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6387118/
https://www.ncbi.nlm.nih.gov/pubmed/30736449
http://dx.doi.org/10.3390/ijms20030717
work_keys_str_mv AT wheelersimon lipidproteininteractionsinniemannpicktypecdiseaseinsightsfrommolecularmodeling
AT schmidralf lipidproteininteractionsinniemannpicktypecdiseaseinsightsfrommolecularmodeling
AT sillencedanj lipidproteininteractionsinniemannpicktypecdiseaseinsightsfrommolecularmodeling