Cargando…
Lipid–Protein Interactions in Niemann–Pick Type C Disease: Insights from Molecular Modeling
The accumulation of lipids in the late endosomes and lysosomes of Niemann–Pick type C disease (NPCD) cells is a consequence of the dysfunction of one protein (usually NPC1) but induces dysfunction in many proteins. We used molecular docking to propose (a) that NPC1 exports not just cholesterol, but...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6387118/ https://www.ncbi.nlm.nih.gov/pubmed/30736449 http://dx.doi.org/10.3390/ijms20030717 |
_version_ | 1783397499841544192 |
---|---|
author | Wheeler, Simon Schmid, Ralf Sillence, Dan J |
author_facet | Wheeler, Simon Schmid, Ralf Sillence, Dan J |
author_sort | Wheeler, Simon |
collection | PubMed |
description | The accumulation of lipids in the late endosomes and lysosomes of Niemann–Pick type C disease (NPCD) cells is a consequence of the dysfunction of one protein (usually NPC1) but induces dysfunction in many proteins. We used molecular docking to propose (a) that NPC1 exports not just cholesterol, but also sphingosine, (b) that the cholesterol sensitivity of big potassium channel (BK) can be traced to a previously unappreciated site on the channel’s voltage sensor, (c) that transient receptor potential mucolipin 1 (TRPML1) inhibition by sphingomyelin is likely an indirect effect, and (d) that phosphoinositides are responsible for both the mislocalization of annexin A2 (AnxA2) and a soluble NSF (N-ethylmaleimide Sensitive Fusion) protein attachment receptor (SNARE) recycling defect. These results are set in the context of existing knowledge of NPCD to sketch an account of the endolysosomal pathology key to this disease. |
format | Online Article Text |
id | pubmed-6387118 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-63871182019-02-27 Lipid–Protein Interactions in Niemann–Pick Type C Disease: Insights from Molecular Modeling Wheeler, Simon Schmid, Ralf Sillence, Dan J Int J Mol Sci Article The accumulation of lipids in the late endosomes and lysosomes of Niemann–Pick type C disease (NPCD) cells is a consequence of the dysfunction of one protein (usually NPC1) but induces dysfunction in many proteins. We used molecular docking to propose (a) that NPC1 exports not just cholesterol, but also sphingosine, (b) that the cholesterol sensitivity of big potassium channel (BK) can be traced to a previously unappreciated site on the channel’s voltage sensor, (c) that transient receptor potential mucolipin 1 (TRPML1) inhibition by sphingomyelin is likely an indirect effect, and (d) that phosphoinositides are responsible for both the mislocalization of annexin A2 (AnxA2) and a soluble NSF (N-ethylmaleimide Sensitive Fusion) protein attachment receptor (SNARE) recycling defect. These results are set in the context of existing knowledge of NPCD to sketch an account of the endolysosomal pathology key to this disease. MDPI 2019-02-07 /pmc/articles/PMC6387118/ /pubmed/30736449 http://dx.doi.org/10.3390/ijms20030717 Text en © 2019 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Wheeler, Simon Schmid, Ralf Sillence, Dan J Lipid–Protein Interactions in Niemann–Pick Type C Disease: Insights from Molecular Modeling |
title | Lipid–Protein Interactions in Niemann–Pick Type C Disease: Insights from Molecular Modeling |
title_full | Lipid–Protein Interactions in Niemann–Pick Type C Disease: Insights from Molecular Modeling |
title_fullStr | Lipid–Protein Interactions in Niemann–Pick Type C Disease: Insights from Molecular Modeling |
title_full_unstemmed | Lipid–Protein Interactions in Niemann–Pick Type C Disease: Insights from Molecular Modeling |
title_short | Lipid–Protein Interactions in Niemann–Pick Type C Disease: Insights from Molecular Modeling |
title_sort | lipid–protein interactions in niemann–pick type c disease: insights from molecular modeling |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6387118/ https://www.ncbi.nlm.nih.gov/pubmed/30736449 http://dx.doi.org/10.3390/ijms20030717 |
work_keys_str_mv | AT wheelersimon lipidproteininteractionsinniemannpicktypecdiseaseinsightsfrommolecularmodeling AT schmidralf lipidproteininteractionsinniemannpicktypecdiseaseinsightsfrommolecularmodeling AT sillencedanj lipidproteininteractionsinniemannpicktypecdiseaseinsightsfrommolecularmodeling |