Cargando…
The cAMP Pathway Amplifies Early MyD88-Dependent and Type I Interferon-Independent LPS-Induced Interleukin-10 Expression in Mouse Macrophages
Interleukin-10 (IL-10) is a key anti-inflammatory cytokine, secreted by macrophages and other immune cells to attenuate inflammation. Autocrine type I interferons (IFNs) largely mediate the delayed expression of IL-10 by LPS-stimulated macrophages. We have previously shown that IL-10 is synergistica...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6501241/ https://www.ncbi.nlm.nih.gov/pubmed/31148944 http://dx.doi.org/10.1155/2019/3451461 |
_version_ | 1783416075837243392 |
---|---|
author | Ernst, Orna Glucksam-Galnoy, Yifat Athamna, Muhammad Ben-Dror, Iris Ben-Arosh, Hadar Levy-Rimler, Galit Fraser, Iain D. C. Zor, Tsaffrir |
author_facet | Ernst, Orna Glucksam-Galnoy, Yifat Athamna, Muhammad Ben-Dror, Iris Ben-Arosh, Hadar Levy-Rimler, Galit Fraser, Iain D. C. Zor, Tsaffrir |
author_sort | Ernst, Orna |
collection | PubMed |
description | Interleukin-10 (IL-10) is a key anti-inflammatory cytokine, secreted by macrophages and other immune cells to attenuate inflammation. Autocrine type I interferons (IFNs) largely mediate the delayed expression of IL-10 by LPS-stimulated macrophages. We have previously shown that IL-10 is synergistically expressed in macrophages following a costimulus of a TLR agonist and cAMP. We now show that the cAMP pathway directly upregulates IL-10 transcription and plays an important permissive and synergistic role in early, but not late, LPS-stimulated IL-10 mRNA and protein expression in mouse macrophages and in a mouse septic shock model. Our results suggest that the loss of synergism is not due to desensitization of the cAMP inducing signal, and it is not mediated by a positive crosstalk between the cAMP and type I IFN pathways. First, cAMP elevation in LPS-treated cells decreased the secretion of type I IFN. Second, autocrine/paracrine type I IFNs induce IL-10 promoter reporter activity only additively, but not synergistically, with the cAMP pathway. IL-10 promoter reporter activity was synergistically induced by cAMP elevation in macrophages stimulated by an agonist of either TLR4, TLR2/6, or TLR7, receptors which signal via MyD88, but not by an agonist of TLR3 which signals independently of MyD88. Moreover, MyD88 knockout largely reduced the synergistic IL-10 expression, indicating that MyD88 is required for the synergism displayed by LPS with cAMP. This report delineates the temporal regulation of early cAMP-accelerated vs. late type I IFN-dependent IL-10 transcription in LPS-stimulated murine macrophages that can limit inflammation at its onset. |
format | Online Article Text |
id | pubmed-6501241 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Hindawi |
record_format | MEDLINE/PubMed |
spelling | pubmed-65012412019-05-30 The cAMP Pathway Amplifies Early MyD88-Dependent and Type I Interferon-Independent LPS-Induced Interleukin-10 Expression in Mouse Macrophages Ernst, Orna Glucksam-Galnoy, Yifat Athamna, Muhammad Ben-Dror, Iris Ben-Arosh, Hadar Levy-Rimler, Galit Fraser, Iain D. C. Zor, Tsaffrir Mediators Inflamm Research Article Interleukin-10 (IL-10) is a key anti-inflammatory cytokine, secreted by macrophages and other immune cells to attenuate inflammation. Autocrine type I interferons (IFNs) largely mediate the delayed expression of IL-10 by LPS-stimulated macrophages. We have previously shown that IL-10 is synergistically expressed in macrophages following a costimulus of a TLR agonist and cAMP. We now show that the cAMP pathway directly upregulates IL-10 transcription and plays an important permissive and synergistic role in early, but not late, LPS-stimulated IL-10 mRNA and protein expression in mouse macrophages and in a mouse septic shock model. Our results suggest that the loss of synergism is not due to desensitization of the cAMP inducing signal, and it is not mediated by a positive crosstalk between the cAMP and type I IFN pathways. First, cAMP elevation in LPS-treated cells decreased the secretion of type I IFN. Second, autocrine/paracrine type I IFNs induce IL-10 promoter reporter activity only additively, but not synergistically, with the cAMP pathway. IL-10 promoter reporter activity was synergistically induced by cAMP elevation in macrophages stimulated by an agonist of either TLR4, TLR2/6, or TLR7, receptors which signal via MyD88, but not by an agonist of TLR3 which signals independently of MyD88. Moreover, MyD88 knockout largely reduced the synergistic IL-10 expression, indicating that MyD88 is required for the synergism displayed by LPS with cAMP. This report delineates the temporal regulation of early cAMP-accelerated vs. late type I IFN-dependent IL-10 transcription in LPS-stimulated murine macrophages that can limit inflammation at its onset. Hindawi 2019-04-17 /pmc/articles/PMC6501241/ /pubmed/31148944 http://dx.doi.org/10.1155/2019/3451461 Text en Copyright © 2019 Orna Ernst et al. http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Ernst, Orna Glucksam-Galnoy, Yifat Athamna, Muhammad Ben-Dror, Iris Ben-Arosh, Hadar Levy-Rimler, Galit Fraser, Iain D. C. Zor, Tsaffrir The cAMP Pathway Amplifies Early MyD88-Dependent and Type I Interferon-Independent LPS-Induced Interleukin-10 Expression in Mouse Macrophages |
title | The cAMP Pathway Amplifies Early MyD88-Dependent and Type I Interferon-Independent LPS-Induced Interleukin-10 Expression in Mouse Macrophages |
title_full | The cAMP Pathway Amplifies Early MyD88-Dependent and Type I Interferon-Independent LPS-Induced Interleukin-10 Expression in Mouse Macrophages |
title_fullStr | The cAMP Pathway Amplifies Early MyD88-Dependent and Type I Interferon-Independent LPS-Induced Interleukin-10 Expression in Mouse Macrophages |
title_full_unstemmed | The cAMP Pathway Amplifies Early MyD88-Dependent and Type I Interferon-Independent LPS-Induced Interleukin-10 Expression in Mouse Macrophages |
title_short | The cAMP Pathway Amplifies Early MyD88-Dependent and Type I Interferon-Independent LPS-Induced Interleukin-10 Expression in Mouse Macrophages |
title_sort | camp pathway amplifies early myd88-dependent and type i interferon-independent lps-induced interleukin-10 expression in mouse macrophages |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6501241/ https://www.ncbi.nlm.nih.gov/pubmed/31148944 http://dx.doi.org/10.1155/2019/3451461 |
work_keys_str_mv | AT ernstorna thecamppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages AT glucksamgalnoyyifat thecamppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages AT athamnamuhammad thecamppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages AT bendroriris thecamppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages AT benaroshhadar thecamppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages AT levyrimlergalit thecamppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages AT fraseriaindc thecamppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages AT zortsaffrir thecamppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages AT ernstorna camppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages AT glucksamgalnoyyifat camppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages AT athamnamuhammad camppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages AT bendroriris camppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages AT benaroshhadar camppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages AT levyrimlergalit camppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages AT fraseriaindc camppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages AT zortsaffrir camppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages |