Cargando…

The cAMP Pathway Amplifies Early MyD88-Dependent and Type I Interferon-Independent LPS-Induced Interleukin-10 Expression in Mouse Macrophages

Interleukin-10 (IL-10) is a key anti-inflammatory cytokine, secreted by macrophages and other immune cells to attenuate inflammation. Autocrine type I interferons (IFNs) largely mediate the delayed expression of IL-10 by LPS-stimulated macrophages. We have previously shown that IL-10 is synergistica...

Descripción completa

Detalles Bibliográficos
Autores principales: Ernst, Orna, Glucksam-Galnoy, Yifat, Athamna, Muhammad, Ben-Dror, Iris, Ben-Arosh, Hadar, Levy-Rimler, Galit, Fraser, Iain D. C., Zor, Tsaffrir
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Hindawi 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6501241/
https://www.ncbi.nlm.nih.gov/pubmed/31148944
http://dx.doi.org/10.1155/2019/3451461
_version_ 1783416075837243392
author Ernst, Orna
Glucksam-Galnoy, Yifat
Athamna, Muhammad
Ben-Dror, Iris
Ben-Arosh, Hadar
Levy-Rimler, Galit
Fraser, Iain D. C.
Zor, Tsaffrir
author_facet Ernst, Orna
Glucksam-Galnoy, Yifat
Athamna, Muhammad
Ben-Dror, Iris
Ben-Arosh, Hadar
Levy-Rimler, Galit
Fraser, Iain D. C.
Zor, Tsaffrir
author_sort Ernst, Orna
collection PubMed
description Interleukin-10 (IL-10) is a key anti-inflammatory cytokine, secreted by macrophages and other immune cells to attenuate inflammation. Autocrine type I interferons (IFNs) largely mediate the delayed expression of IL-10 by LPS-stimulated macrophages. We have previously shown that IL-10 is synergistically expressed in macrophages following a costimulus of a TLR agonist and cAMP. We now show that the cAMP pathway directly upregulates IL-10 transcription and plays an important permissive and synergistic role in early, but not late, LPS-stimulated IL-10 mRNA and protein expression in mouse macrophages and in a mouse septic shock model. Our results suggest that the loss of synergism is not due to desensitization of the cAMP inducing signal, and it is not mediated by a positive crosstalk between the cAMP and type I IFN pathways. First, cAMP elevation in LPS-treated cells decreased the secretion of type I IFN. Second, autocrine/paracrine type I IFNs induce IL-10 promoter reporter activity only additively, but not synergistically, with the cAMP pathway. IL-10 promoter reporter activity was synergistically induced by cAMP elevation in macrophages stimulated by an agonist of either TLR4, TLR2/6, or TLR7, receptors which signal via MyD88, but not by an agonist of TLR3 which signals independently of MyD88. Moreover, MyD88 knockout largely reduced the synergistic IL-10 expression, indicating that MyD88 is required for the synergism displayed by LPS with cAMP. This report delineates the temporal regulation of early cAMP-accelerated vs. late type I IFN-dependent IL-10 transcription in LPS-stimulated murine macrophages that can limit inflammation at its onset.
format Online
Article
Text
id pubmed-6501241
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Hindawi
record_format MEDLINE/PubMed
spelling pubmed-65012412019-05-30 The cAMP Pathway Amplifies Early MyD88-Dependent and Type I Interferon-Independent LPS-Induced Interleukin-10 Expression in Mouse Macrophages Ernst, Orna Glucksam-Galnoy, Yifat Athamna, Muhammad Ben-Dror, Iris Ben-Arosh, Hadar Levy-Rimler, Galit Fraser, Iain D. C. Zor, Tsaffrir Mediators Inflamm Research Article Interleukin-10 (IL-10) is a key anti-inflammatory cytokine, secreted by macrophages and other immune cells to attenuate inflammation. Autocrine type I interferons (IFNs) largely mediate the delayed expression of IL-10 by LPS-stimulated macrophages. We have previously shown that IL-10 is synergistically expressed in macrophages following a costimulus of a TLR agonist and cAMP. We now show that the cAMP pathway directly upregulates IL-10 transcription and plays an important permissive and synergistic role in early, but not late, LPS-stimulated IL-10 mRNA and protein expression in mouse macrophages and in a mouse septic shock model. Our results suggest that the loss of synergism is not due to desensitization of the cAMP inducing signal, and it is not mediated by a positive crosstalk between the cAMP and type I IFN pathways. First, cAMP elevation in LPS-treated cells decreased the secretion of type I IFN. Second, autocrine/paracrine type I IFNs induce IL-10 promoter reporter activity only additively, but not synergistically, with the cAMP pathway. IL-10 promoter reporter activity was synergistically induced by cAMP elevation in macrophages stimulated by an agonist of either TLR4, TLR2/6, or TLR7, receptors which signal via MyD88, but not by an agonist of TLR3 which signals independently of MyD88. Moreover, MyD88 knockout largely reduced the synergistic IL-10 expression, indicating that MyD88 is required for the synergism displayed by LPS with cAMP. This report delineates the temporal regulation of early cAMP-accelerated vs. late type I IFN-dependent IL-10 transcription in LPS-stimulated murine macrophages that can limit inflammation at its onset. Hindawi 2019-04-17 /pmc/articles/PMC6501241/ /pubmed/31148944 http://dx.doi.org/10.1155/2019/3451461 Text en Copyright © 2019 Orna Ernst et al. http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Article
Ernst, Orna
Glucksam-Galnoy, Yifat
Athamna, Muhammad
Ben-Dror, Iris
Ben-Arosh, Hadar
Levy-Rimler, Galit
Fraser, Iain D. C.
Zor, Tsaffrir
The cAMP Pathway Amplifies Early MyD88-Dependent and Type I Interferon-Independent LPS-Induced Interleukin-10 Expression in Mouse Macrophages
title The cAMP Pathway Amplifies Early MyD88-Dependent and Type I Interferon-Independent LPS-Induced Interleukin-10 Expression in Mouse Macrophages
title_full The cAMP Pathway Amplifies Early MyD88-Dependent and Type I Interferon-Independent LPS-Induced Interleukin-10 Expression in Mouse Macrophages
title_fullStr The cAMP Pathway Amplifies Early MyD88-Dependent and Type I Interferon-Independent LPS-Induced Interleukin-10 Expression in Mouse Macrophages
title_full_unstemmed The cAMP Pathway Amplifies Early MyD88-Dependent and Type I Interferon-Independent LPS-Induced Interleukin-10 Expression in Mouse Macrophages
title_short The cAMP Pathway Amplifies Early MyD88-Dependent and Type I Interferon-Independent LPS-Induced Interleukin-10 Expression in Mouse Macrophages
title_sort camp pathway amplifies early myd88-dependent and type i interferon-independent lps-induced interleukin-10 expression in mouse macrophages
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6501241/
https://www.ncbi.nlm.nih.gov/pubmed/31148944
http://dx.doi.org/10.1155/2019/3451461
work_keys_str_mv AT ernstorna thecamppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages
AT glucksamgalnoyyifat thecamppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages
AT athamnamuhammad thecamppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages
AT bendroriris thecamppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages
AT benaroshhadar thecamppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages
AT levyrimlergalit thecamppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages
AT fraseriaindc thecamppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages
AT zortsaffrir thecamppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages
AT ernstorna camppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages
AT glucksamgalnoyyifat camppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages
AT athamnamuhammad camppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages
AT bendroriris camppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages
AT benaroshhadar camppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages
AT levyrimlergalit camppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages
AT fraseriaindc camppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages
AT zortsaffrir camppathwayamplifiesearlymyd88dependentandtypeiinterferonindependentlpsinducedinterleukin10expressioninmousemacrophages