Cargando…

Modulation of SUR1 K(ATP) Channel Subunit Activity in the Peripheral Nervous System Reduces Mechanical Hyperalgesia after Nerve Injury in Mice

The ATP-sensitive K(+) channel (K(ATP)) is involved in hypersensitivity during chronic pain and is presumed to be a downstream target of mu opioid receptors. Multiple subtypes of K(ATP) channels exist in the peripheral and central nervous system and their activity may be inversely correlated to chro...

Descripción completa

Detalles Bibliográficos
Autores principales: Luu, Wing, Bjork, James, Salo, Erin, Entenmann, Nicole, Jurgenson, Taylor, Fisher, Cole, Klein, Amanda H.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6539735/
https://www.ncbi.nlm.nih.gov/pubmed/31067750
http://dx.doi.org/10.3390/ijms20092251
_version_ 1783422459281670144
author Luu, Wing
Bjork, James
Salo, Erin
Entenmann, Nicole
Jurgenson, Taylor
Fisher, Cole
Klein, Amanda H.
author_facet Luu, Wing
Bjork, James
Salo, Erin
Entenmann, Nicole
Jurgenson, Taylor
Fisher, Cole
Klein, Amanda H.
author_sort Luu, Wing
collection PubMed
description The ATP-sensitive K(+) channel (K(ATP)) is involved in hypersensitivity during chronic pain and is presumed to be a downstream target of mu opioid receptors. Multiple subtypes of K(ATP) channels exist in the peripheral and central nervous system and their activity may be inversely correlated to chronic pain phenotypes in rodents. In this study, we investigated the different K(ATP) channel subunits that could be involved in neuropathic pain in mice. In chronic pain models utilizing spinal nerve ligation, SUR1 and Kir6.2 subunits were found to be significantly downregulated in dorsal root ganglia and the spinal cord. Local or intrathecal administration of SUR1-K(ATP) channel subtype agonists resulted in analgesia after spinal nerve ligation but not SUR2 agonists. In ex-vivo nerve recordings, administration of the SUR1 agonist diazoxide to peripheral nerve terminals decreased mechanically evoked potentials. Genetic knockdown of SUR1 through an associated adenoviral strategy resulted in mechanical hyperalgesia but not thermal hyperalgesia compared to control mice. Behavioral data from neuropathic mice indicate that local reductions in SUR1-subtype K(ATP) channel activity can exacerbate neuropathic pain symptoms. Since neuropathic pain is of major clinical relevance, potassium channels present a target for analgesic therapies, especially since they are expressed in nociceptors and could play an essential role in regulating the excitability of neurons involved in pain-transmission.
format Online
Article
Text
id pubmed-6539735
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-65397352019-06-04 Modulation of SUR1 K(ATP) Channel Subunit Activity in the Peripheral Nervous System Reduces Mechanical Hyperalgesia after Nerve Injury in Mice Luu, Wing Bjork, James Salo, Erin Entenmann, Nicole Jurgenson, Taylor Fisher, Cole Klein, Amanda H. Int J Mol Sci Article The ATP-sensitive K(+) channel (K(ATP)) is involved in hypersensitivity during chronic pain and is presumed to be a downstream target of mu opioid receptors. Multiple subtypes of K(ATP) channels exist in the peripheral and central nervous system and their activity may be inversely correlated to chronic pain phenotypes in rodents. In this study, we investigated the different K(ATP) channel subunits that could be involved in neuropathic pain in mice. In chronic pain models utilizing spinal nerve ligation, SUR1 and Kir6.2 subunits were found to be significantly downregulated in dorsal root ganglia and the spinal cord. Local or intrathecal administration of SUR1-K(ATP) channel subtype agonists resulted in analgesia after spinal nerve ligation but not SUR2 agonists. In ex-vivo nerve recordings, administration of the SUR1 agonist diazoxide to peripheral nerve terminals decreased mechanically evoked potentials. Genetic knockdown of SUR1 through an associated adenoviral strategy resulted in mechanical hyperalgesia but not thermal hyperalgesia compared to control mice. Behavioral data from neuropathic mice indicate that local reductions in SUR1-subtype K(ATP) channel activity can exacerbate neuropathic pain symptoms. Since neuropathic pain is of major clinical relevance, potassium channels present a target for analgesic therapies, especially since they are expressed in nociceptors and could play an essential role in regulating the excitability of neurons involved in pain-transmission. MDPI 2019-05-07 /pmc/articles/PMC6539735/ /pubmed/31067750 http://dx.doi.org/10.3390/ijms20092251 Text en © 2019 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Luu, Wing
Bjork, James
Salo, Erin
Entenmann, Nicole
Jurgenson, Taylor
Fisher, Cole
Klein, Amanda H.
Modulation of SUR1 K(ATP) Channel Subunit Activity in the Peripheral Nervous System Reduces Mechanical Hyperalgesia after Nerve Injury in Mice
title Modulation of SUR1 K(ATP) Channel Subunit Activity in the Peripheral Nervous System Reduces Mechanical Hyperalgesia after Nerve Injury in Mice
title_full Modulation of SUR1 K(ATP) Channel Subunit Activity in the Peripheral Nervous System Reduces Mechanical Hyperalgesia after Nerve Injury in Mice
title_fullStr Modulation of SUR1 K(ATP) Channel Subunit Activity in the Peripheral Nervous System Reduces Mechanical Hyperalgesia after Nerve Injury in Mice
title_full_unstemmed Modulation of SUR1 K(ATP) Channel Subunit Activity in the Peripheral Nervous System Reduces Mechanical Hyperalgesia after Nerve Injury in Mice
title_short Modulation of SUR1 K(ATP) Channel Subunit Activity in the Peripheral Nervous System Reduces Mechanical Hyperalgesia after Nerve Injury in Mice
title_sort modulation of sur1 k(atp) channel subunit activity in the peripheral nervous system reduces mechanical hyperalgesia after nerve injury in mice
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6539735/
https://www.ncbi.nlm.nih.gov/pubmed/31067750
http://dx.doi.org/10.3390/ijms20092251
work_keys_str_mv AT luuwing modulationofsur1katpchannelsubunitactivityintheperipheralnervoussystemreducesmechanicalhyperalgesiaafternerveinjuryinmice
AT bjorkjames modulationofsur1katpchannelsubunitactivityintheperipheralnervoussystemreducesmechanicalhyperalgesiaafternerveinjuryinmice
AT saloerin modulationofsur1katpchannelsubunitactivityintheperipheralnervoussystemreducesmechanicalhyperalgesiaafternerveinjuryinmice
AT entenmannnicole modulationofsur1katpchannelsubunitactivityintheperipheralnervoussystemreducesmechanicalhyperalgesiaafternerveinjuryinmice
AT jurgensontaylor modulationofsur1katpchannelsubunitactivityintheperipheralnervoussystemreducesmechanicalhyperalgesiaafternerveinjuryinmice
AT fishercole modulationofsur1katpchannelsubunitactivityintheperipheralnervoussystemreducesmechanicalhyperalgesiaafternerveinjuryinmice
AT kleinamandah modulationofsur1katpchannelsubunitactivityintheperipheralnervoussystemreducesmechanicalhyperalgesiaafternerveinjuryinmice