Cargando…

Naturally Occurring Sesquiterpene Lactone-Santonin, Exerts Anticancer Effects in Multi-Drug Resistant Breast Cancer Cells by Inducing Mitochondrial Mediated Apoptosis, Caspase Activation, Cell Cycle Arrest, and by Targeting Ras/Raf/MEK/ERK Signaling Pathway

BACKGROUND: Sesquiterpene lactones have gained tremendous attention owing to their potent anticancer properties. The main focus of this study was to evaluate the anticancer effects of a naturally occurring sesquiterpene lactone, santonin, against human breast cancer SK-BR-3 cells. MATERIAL/METHODS:...

Descripción completa

Detalles Bibliográficos
Autores principales: Wu, Zhiqiang, Wang, Chenchen, Huang, Mingzhu, Tao, Zhonghua, Yan, Wangjun, Du, Yiqun
Formato: Online Artículo Texto
Lenguaje:English
Publicado: International Scientific Literature, Inc. 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6540632/
https://www.ncbi.nlm.nih.gov/pubmed/31101800
http://dx.doi.org/10.12659/MSM.915246
_version_ 1783422661775327232
author Wu, Zhiqiang
Wang, Chenchen
Huang, Mingzhu
Tao, Zhonghua
Yan, Wangjun
Du, Yiqun
author_facet Wu, Zhiqiang
Wang, Chenchen
Huang, Mingzhu
Tao, Zhonghua
Yan, Wangjun
Du, Yiqun
author_sort Wu, Zhiqiang
collection PubMed
description BACKGROUND: Sesquiterpene lactones have gained tremendous attention owing to their potent anticancer properties. The main focus of this study was to evaluate the anticancer effects of a naturally occurring sesquiterpene lactone, santonin, against human breast cancer SK-BR-3 cells. MATERIAL/METHODS: Cell counting kit 8 assay was used for the determination of cell viability. Apoptosis was detected by DAPI (4′,6-diamidino-2-phenylindole) and annexin V/propidium iodide (IP) staining. Flow cytometry was used for cell cycle analysis and western blotting was used for the estimation of protein expression. RESULTS: Results showed that santonin exerts significant anti-proliferative effects on the SK-BR-3 breast cancer cells in a concentration dependent manner. Santonin showed an IC(50) of 16 μM against SK-BR-3 cells. DAPI staining showed that santonin caused DNA fragmentation in the SK-BR-3 cells, which is indicative of apoptosis. Annexin V/PI staining showed that apoptotic cell percentage increased up to 34.32% at 32 μM concentration of santonin. Santonin also caused an increase in the expression of Bax, caspase-3, and caspase-9, and a decrease in the expression of Bcl-2. Santonin also caused the arrest of the SK-BR-3 cells at the G2/M phase of the cell cycle and suppressed the expression of cyclin A and B1. Finally, santonin could also block the Raf/MEK/ERK pathway in breast cancer cells. CONCLUSIONS: The findings of this study suggest the potential for the naturally occurring sesquiterpene lactone santonin in breast cancer treatment and also suggest that it could be developed as a promising anticancer agent.
format Online
Article
Text
id pubmed-6540632
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher International Scientific Literature, Inc.
record_format MEDLINE/PubMed
spelling pubmed-65406322019-06-12 Naturally Occurring Sesquiterpene Lactone-Santonin, Exerts Anticancer Effects in Multi-Drug Resistant Breast Cancer Cells by Inducing Mitochondrial Mediated Apoptosis, Caspase Activation, Cell Cycle Arrest, and by Targeting Ras/Raf/MEK/ERK Signaling Pathway Wu, Zhiqiang Wang, Chenchen Huang, Mingzhu Tao, Zhonghua Yan, Wangjun Du, Yiqun Med Sci Monit Lab/In Vitro Research BACKGROUND: Sesquiterpene lactones have gained tremendous attention owing to their potent anticancer properties. The main focus of this study was to evaluate the anticancer effects of a naturally occurring sesquiterpene lactone, santonin, against human breast cancer SK-BR-3 cells. MATERIAL/METHODS: Cell counting kit 8 assay was used for the determination of cell viability. Apoptosis was detected by DAPI (4′,6-diamidino-2-phenylindole) and annexin V/propidium iodide (IP) staining. Flow cytometry was used for cell cycle analysis and western blotting was used for the estimation of protein expression. RESULTS: Results showed that santonin exerts significant anti-proliferative effects on the SK-BR-3 breast cancer cells in a concentration dependent manner. Santonin showed an IC(50) of 16 μM against SK-BR-3 cells. DAPI staining showed that santonin caused DNA fragmentation in the SK-BR-3 cells, which is indicative of apoptosis. Annexin V/PI staining showed that apoptotic cell percentage increased up to 34.32% at 32 μM concentration of santonin. Santonin also caused an increase in the expression of Bax, caspase-3, and caspase-9, and a decrease in the expression of Bcl-2. Santonin also caused the arrest of the SK-BR-3 cells at the G2/M phase of the cell cycle and suppressed the expression of cyclin A and B1. Finally, santonin could also block the Raf/MEK/ERK pathway in breast cancer cells. CONCLUSIONS: The findings of this study suggest the potential for the naturally occurring sesquiterpene lactone santonin in breast cancer treatment and also suggest that it could be developed as a promising anticancer agent. International Scientific Literature, Inc. 2019-05-18 /pmc/articles/PMC6540632/ /pubmed/31101800 http://dx.doi.org/10.12659/MSM.915246 Text en © Med Sci Monit, 2019 This work is licensed under Creative Common Attribution-NonCommercial-NoDerivatives 4.0 International (CC BY-NC-ND 4.0 (https://creativecommons.org/licenses/by-nc-nd/4.0/) )
spellingShingle Lab/In Vitro Research
Wu, Zhiqiang
Wang, Chenchen
Huang, Mingzhu
Tao, Zhonghua
Yan, Wangjun
Du, Yiqun
Naturally Occurring Sesquiterpene Lactone-Santonin, Exerts Anticancer Effects in Multi-Drug Resistant Breast Cancer Cells by Inducing Mitochondrial Mediated Apoptosis, Caspase Activation, Cell Cycle Arrest, and by Targeting Ras/Raf/MEK/ERK Signaling Pathway
title Naturally Occurring Sesquiterpene Lactone-Santonin, Exerts Anticancer Effects in Multi-Drug Resistant Breast Cancer Cells by Inducing Mitochondrial Mediated Apoptosis, Caspase Activation, Cell Cycle Arrest, and by Targeting Ras/Raf/MEK/ERK Signaling Pathway
title_full Naturally Occurring Sesquiterpene Lactone-Santonin, Exerts Anticancer Effects in Multi-Drug Resistant Breast Cancer Cells by Inducing Mitochondrial Mediated Apoptosis, Caspase Activation, Cell Cycle Arrest, and by Targeting Ras/Raf/MEK/ERK Signaling Pathway
title_fullStr Naturally Occurring Sesquiterpene Lactone-Santonin, Exerts Anticancer Effects in Multi-Drug Resistant Breast Cancer Cells by Inducing Mitochondrial Mediated Apoptosis, Caspase Activation, Cell Cycle Arrest, and by Targeting Ras/Raf/MEK/ERK Signaling Pathway
title_full_unstemmed Naturally Occurring Sesquiterpene Lactone-Santonin, Exerts Anticancer Effects in Multi-Drug Resistant Breast Cancer Cells by Inducing Mitochondrial Mediated Apoptosis, Caspase Activation, Cell Cycle Arrest, and by Targeting Ras/Raf/MEK/ERK Signaling Pathway
title_short Naturally Occurring Sesquiterpene Lactone-Santonin, Exerts Anticancer Effects in Multi-Drug Resistant Breast Cancer Cells by Inducing Mitochondrial Mediated Apoptosis, Caspase Activation, Cell Cycle Arrest, and by Targeting Ras/Raf/MEK/ERK Signaling Pathway
title_sort naturally occurring sesquiterpene lactone-santonin, exerts anticancer effects in multi-drug resistant breast cancer cells by inducing mitochondrial mediated apoptosis, caspase activation, cell cycle arrest, and by targeting ras/raf/mek/erk signaling pathway
topic Lab/In Vitro Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6540632/
https://www.ncbi.nlm.nih.gov/pubmed/31101800
http://dx.doi.org/10.12659/MSM.915246
work_keys_str_mv AT wuzhiqiang naturallyoccurringsesquiterpenelactonesantoninexertsanticancereffectsinmultidrugresistantbreastcancercellsbyinducingmitochondrialmediatedapoptosiscaspaseactivationcellcyclearrestandbytargetingrasrafmekerksignalingpathway
AT wangchenchen naturallyoccurringsesquiterpenelactonesantoninexertsanticancereffectsinmultidrugresistantbreastcancercellsbyinducingmitochondrialmediatedapoptosiscaspaseactivationcellcyclearrestandbytargetingrasrafmekerksignalingpathway
AT huangmingzhu naturallyoccurringsesquiterpenelactonesantoninexertsanticancereffectsinmultidrugresistantbreastcancercellsbyinducingmitochondrialmediatedapoptosiscaspaseactivationcellcyclearrestandbytargetingrasrafmekerksignalingpathway
AT taozhonghua naturallyoccurringsesquiterpenelactonesantoninexertsanticancereffectsinmultidrugresistantbreastcancercellsbyinducingmitochondrialmediatedapoptosiscaspaseactivationcellcyclearrestandbytargetingrasrafmekerksignalingpathway
AT yanwangjun naturallyoccurringsesquiterpenelactonesantoninexertsanticancereffectsinmultidrugresistantbreastcancercellsbyinducingmitochondrialmediatedapoptosiscaspaseactivationcellcyclearrestandbytargetingrasrafmekerksignalingpathway
AT duyiqun naturallyoccurringsesquiterpenelactonesantoninexertsanticancereffectsinmultidrugresistantbreastcancercellsbyinducingmitochondrialmediatedapoptosiscaspaseactivationcellcyclearrestandbytargetingrasrafmekerksignalingpathway