Cargando…
Naturally Occurring Sesquiterpene Lactone-Santonin, Exerts Anticancer Effects in Multi-Drug Resistant Breast Cancer Cells by Inducing Mitochondrial Mediated Apoptosis, Caspase Activation, Cell Cycle Arrest, and by Targeting Ras/Raf/MEK/ERK Signaling Pathway
BACKGROUND: Sesquiterpene lactones have gained tremendous attention owing to their potent anticancer properties. The main focus of this study was to evaluate the anticancer effects of a naturally occurring sesquiterpene lactone, santonin, against human breast cancer SK-BR-3 cells. MATERIAL/METHODS:...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
International Scientific Literature, Inc.
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6540632/ https://www.ncbi.nlm.nih.gov/pubmed/31101800 http://dx.doi.org/10.12659/MSM.915246 |
_version_ | 1783422661775327232 |
---|---|
author | Wu, Zhiqiang Wang, Chenchen Huang, Mingzhu Tao, Zhonghua Yan, Wangjun Du, Yiqun |
author_facet | Wu, Zhiqiang Wang, Chenchen Huang, Mingzhu Tao, Zhonghua Yan, Wangjun Du, Yiqun |
author_sort | Wu, Zhiqiang |
collection | PubMed |
description | BACKGROUND: Sesquiterpene lactones have gained tremendous attention owing to their potent anticancer properties. The main focus of this study was to evaluate the anticancer effects of a naturally occurring sesquiterpene lactone, santonin, against human breast cancer SK-BR-3 cells. MATERIAL/METHODS: Cell counting kit 8 assay was used for the determination of cell viability. Apoptosis was detected by DAPI (4′,6-diamidino-2-phenylindole) and annexin V/propidium iodide (IP) staining. Flow cytometry was used for cell cycle analysis and western blotting was used for the estimation of protein expression. RESULTS: Results showed that santonin exerts significant anti-proliferative effects on the SK-BR-3 breast cancer cells in a concentration dependent manner. Santonin showed an IC(50) of 16 μM against SK-BR-3 cells. DAPI staining showed that santonin caused DNA fragmentation in the SK-BR-3 cells, which is indicative of apoptosis. Annexin V/PI staining showed that apoptotic cell percentage increased up to 34.32% at 32 μM concentration of santonin. Santonin also caused an increase in the expression of Bax, caspase-3, and caspase-9, and a decrease in the expression of Bcl-2. Santonin also caused the arrest of the SK-BR-3 cells at the G2/M phase of the cell cycle and suppressed the expression of cyclin A and B1. Finally, santonin could also block the Raf/MEK/ERK pathway in breast cancer cells. CONCLUSIONS: The findings of this study suggest the potential for the naturally occurring sesquiterpene lactone santonin in breast cancer treatment and also suggest that it could be developed as a promising anticancer agent. |
format | Online Article Text |
id | pubmed-6540632 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | International Scientific Literature, Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-65406322019-06-12 Naturally Occurring Sesquiterpene Lactone-Santonin, Exerts Anticancer Effects in Multi-Drug Resistant Breast Cancer Cells by Inducing Mitochondrial Mediated Apoptosis, Caspase Activation, Cell Cycle Arrest, and by Targeting Ras/Raf/MEK/ERK Signaling Pathway Wu, Zhiqiang Wang, Chenchen Huang, Mingzhu Tao, Zhonghua Yan, Wangjun Du, Yiqun Med Sci Monit Lab/In Vitro Research BACKGROUND: Sesquiterpene lactones have gained tremendous attention owing to their potent anticancer properties. The main focus of this study was to evaluate the anticancer effects of a naturally occurring sesquiterpene lactone, santonin, against human breast cancer SK-BR-3 cells. MATERIAL/METHODS: Cell counting kit 8 assay was used for the determination of cell viability. Apoptosis was detected by DAPI (4′,6-diamidino-2-phenylindole) and annexin V/propidium iodide (IP) staining. Flow cytometry was used for cell cycle analysis and western blotting was used for the estimation of protein expression. RESULTS: Results showed that santonin exerts significant anti-proliferative effects on the SK-BR-3 breast cancer cells in a concentration dependent manner. Santonin showed an IC(50) of 16 μM against SK-BR-3 cells. DAPI staining showed that santonin caused DNA fragmentation in the SK-BR-3 cells, which is indicative of apoptosis. Annexin V/PI staining showed that apoptotic cell percentage increased up to 34.32% at 32 μM concentration of santonin. Santonin also caused an increase in the expression of Bax, caspase-3, and caspase-9, and a decrease in the expression of Bcl-2. Santonin also caused the arrest of the SK-BR-3 cells at the G2/M phase of the cell cycle and suppressed the expression of cyclin A and B1. Finally, santonin could also block the Raf/MEK/ERK pathway in breast cancer cells. CONCLUSIONS: The findings of this study suggest the potential for the naturally occurring sesquiterpene lactone santonin in breast cancer treatment and also suggest that it could be developed as a promising anticancer agent. International Scientific Literature, Inc. 2019-05-18 /pmc/articles/PMC6540632/ /pubmed/31101800 http://dx.doi.org/10.12659/MSM.915246 Text en © Med Sci Monit, 2019 This work is licensed under Creative Common Attribution-NonCommercial-NoDerivatives 4.0 International (CC BY-NC-ND 4.0 (https://creativecommons.org/licenses/by-nc-nd/4.0/) ) |
spellingShingle | Lab/In Vitro Research Wu, Zhiqiang Wang, Chenchen Huang, Mingzhu Tao, Zhonghua Yan, Wangjun Du, Yiqun Naturally Occurring Sesquiterpene Lactone-Santonin, Exerts Anticancer Effects in Multi-Drug Resistant Breast Cancer Cells by Inducing Mitochondrial Mediated Apoptosis, Caspase Activation, Cell Cycle Arrest, and by Targeting Ras/Raf/MEK/ERK Signaling Pathway |
title | Naturally Occurring Sesquiterpene Lactone-Santonin, Exerts Anticancer Effects in Multi-Drug Resistant Breast Cancer Cells by Inducing Mitochondrial Mediated Apoptosis, Caspase Activation, Cell Cycle Arrest, and by Targeting Ras/Raf/MEK/ERK Signaling Pathway |
title_full | Naturally Occurring Sesquiterpene Lactone-Santonin, Exerts Anticancer Effects in Multi-Drug Resistant Breast Cancer Cells by Inducing Mitochondrial Mediated Apoptosis, Caspase Activation, Cell Cycle Arrest, and by Targeting Ras/Raf/MEK/ERK Signaling Pathway |
title_fullStr | Naturally Occurring Sesquiterpene Lactone-Santonin, Exerts Anticancer Effects in Multi-Drug Resistant Breast Cancer Cells by Inducing Mitochondrial Mediated Apoptosis, Caspase Activation, Cell Cycle Arrest, and by Targeting Ras/Raf/MEK/ERK Signaling Pathway |
title_full_unstemmed | Naturally Occurring Sesquiterpene Lactone-Santonin, Exerts Anticancer Effects in Multi-Drug Resistant Breast Cancer Cells by Inducing Mitochondrial Mediated Apoptosis, Caspase Activation, Cell Cycle Arrest, and by Targeting Ras/Raf/MEK/ERK Signaling Pathway |
title_short | Naturally Occurring Sesquiterpene Lactone-Santonin, Exerts Anticancer Effects in Multi-Drug Resistant Breast Cancer Cells by Inducing Mitochondrial Mediated Apoptosis, Caspase Activation, Cell Cycle Arrest, and by Targeting Ras/Raf/MEK/ERK Signaling Pathway |
title_sort | naturally occurring sesquiterpene lactone-santonin, exerts anticancer effects in multi-drug resistant breast cancer cells by inducing mitochondrial mediated apoptosis, caspase activation, cell cycle arrest, and by targeting ras/raf/mek/erk signaling pathway |
topic | Lab/In Vitro Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6540632/ https://www.ncbi.nlm.nih.gov/pubmed/31101800 http://dx.doi.org/10.12659/MSM.915246 |
work_keys_str_mv | AT wuzhiqiang naturallyoccurringsesquiterpenelactonesantoninexertsanticancereffectsinmultidrugresistantbreastcancercellsbyinducingmitochondrialmediatedapoptosiscaspaseactivationcellcyclearrestandbytargetingrasrafmekerksignalingpathway AT wangchenchen naturallyoccurringsesquiterpenelactonesantoninexertsanticancereffectsinmultidrugresistantbreastcancercellsbyinducingmitochondrialmediatedapoptosiscaspaseactivationcellcyclearrestandbytargetingrasrafmekerksignalingpathway AT huangmingzhu naturallyoccurringsesquiterpenelactonesantoninexertsanticancereffectsinmultidrugresistantbreastcancercellsbyinducingmitochondrialmediatedapoptosiscaspaseactivationcellcyclearrestandbytargetingrasrafmekerksignalingpathway AT taozhonghua naturallyoccurringsesquiterpenelactonesantoninexertsanticancereffectsinmultidrugresistantbreastcancercellsbyinducingmitochondrialmediatedapoptosiscaspaseactivationcellcyclearrestandbytargetingrasrafmekerksignalingpathway AT yanwangjun naturallyoccurringsesquiterpenelactonesantoninexertsanticancereffectsinmultidrugresistantbreastcancercellsbyinducingmitochondrialmediatedapoptosiscaspaseactivationcellcyclearrestandbytargetingrasrafmekerksignalingpathway AT duyiqun naturallyoccurringsesquiterpenelactonesantoninexertsanticancereffectsinmultidrugresistantbreastcancercellsbyinducingmitochondrialmediatedapoptosiscaspaseactivationcellcyclearrestandbytargetingrasrafmekerksignalingpathway |