Cargando…
NAMPT and NAPRT, Key Enzymes in NAD Salvage Synthesis Pathway, Are of Negative Prognostic Value in Colorectal Cancer
Nicotinamide adenine dinucleotide (NAD) is a profoundly important cofactor in redox reactions. Nicotinamide phosphoribosyltransferase (NAMPT) and nicotinate phosphoribosyltransferase (NAPRT) are key enzymes for NAD salvage biosynthesis pathway, which reciprocally synthesize NAD to supply the main so...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6691178/ https://www.ncbi.nlm.nih.gov/pubmed/31448236 http://dx.doi.org/10.3389/fonc.2019.00736 |
_version_ | 1783443311932997632 |
---|---|
author | Li, Xiao-qin Lei, Jing Mao, Lin-hong Wang, Qing-liang Xu, Feng Ran, Tao Zhou, Zhi-hang He, Song |
author_facet | Li, Xiao-qin Lei, Jing Mao, Lin-hong Wang, Qing-liang Xu, Feng Ran, Tao Zhou, Zhi-hang He, Song |
author_sort | Li, Xiao-qin |
collection | PubMed |
description | Nicotinamide adenine dinucleotide (NAD) is a profoundly important cofactor in redox reactions. Nicotinamide phosphoribosyltransferase (NAMPT) and nicotinate phosphoribosyltransferase (NAPRT) are key enzymes for NAD salvage biosynthesis pathway, which reciprocally synthesize NAD to supply the main source of NAD biosythesis. However, the prognostic value of NAMPT and NAPRT in colorectal cancer (CRC) remains largely unknown. Our present study detected NAMPT and NAPRT protein expression in cancer and adjacent tissues from 261 CRC using immunohistochemical staining. We found that high expression of NAMPT or NAPRT was associated with vascular invasion, invasion depth and advanced TNM stage in CRC. High expression of NAMPT or NAPRT predicts short overall survival and disease-free survival time in CRC patients, which were further confirmed by public datasets. Furthermore, positive correlation between expression of NAMPT and NAPRT was revealed in CRC tissues and cell lines. NAPRT(high)/NAMPT(high) patients tended to have the shortest survival time. Using the TCGA RNA-sequencing data, we showed that gene amplification, mutation, and methylation of NAPRT are more common than NAMPT. On the other hand, NAMPT gene might be targeted by more miRNAs. Finally, genes that are correlated with NAPRT or NAMPT are enriched in different pathways. In conclusion, we found that high expression of NAMPT or NAPRT predicts poor prognosis of CRC patients, but the regulatory mechanism might be distinct from each other. |
format | Online Article Text |
id | pubmed-6691178 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-66911782019-08-23 NAMPT and NAPRT, Key Enzymes in NAD Salvage Synthesis Pathway, Are of Negative Prognostic Value in Colorectal Cancer Li, Xiao-qin Lei, Jing Mao, Lin-hong Wang, Qing-liang Xu, Feng Ran, Tao Zhou, Zhi-hang He, Song Front Oncol Oncology Nicotinamide adenine dinucleotide (NAD) is a profoundly important cofactor in redox reactions. Nicotinamide phosphoribosyltransferase (NAMPT) and nicotinate phosphoribosyltransferase (NAPRT) are key enzymes for NAD salvage biosynthesis pathway, which reciprocally synthesize NAD to supply the main source of NAD biosythesis. However, the prognostic value of NAMPT and NAPRT in colorectal cancer (CRC) remains largely unknown. Our present study detected NAMPT and NAPRT protein expression in cancer and adjacent tissues from 261 CRC using immunohistochemical staining. We found that high expression of NAMPT or NAPRT was associated with vascular invasion, invasion depth and advanced TNM stage in CRC. High expression of NAMPT or NAPRT predicts short overall survival and disease-free survival time in CRC patients, which were further confirmed by public datasets. Furthermore, positive correlation between expression of NAMPT and NAPRT was revealed in CRC tissues and cell lines. NAPRT(high)/NAMPT(high) patients tended to have the shortest survival time. Using the TCGA RNA-sequencing data, we showed that gene amplification, mutation, and methylation of NAPRT are more common than NAMPT. On the other hand, NAMPT gene might be targeted by more miRNAs. Finally, genes that are correlated with NAPRT or NAMPT are enriched in different pathways. In conclusion, we found that high expression of NAMPT or NAPRT predicts poor prognosis of CRC patients, but the regulatory mechanism might be distinct from each other. Frontiers Media S.A. 2019-08-06 /pmc/articles/PMC6691178/ /pubmed/31448236 http://dx.doi.org/10.3389/fonc.2019.00736 Text en Copyright © 2019 Li, Lei, Mao, Wang, Xu, Ran, Zhou and He. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Oncology Li, Xiao-qin Lei, Jing Mao, Lin-hong Wang, Qing-liang Xu, Feng Ran, Tao Zhou, Zhi-hang He, Song NAMPT and NAPRT, Key Enzymes in NAD Salvage Synthesis Pathway, Are of Negative Prognostic Value in Colorectal Cancer |
title | NAMPT and NAPRT, Key Enzymes in NAD Salvage Synthesis Pathway, Are of Negative Prognostic Value in Colorectal Cancer |
title_full | NAMPT and NAPRT, Key Enzymes in NAD Salvage Synthesis Pathway, Are of Negative Prognostic Value in Colorectal Cancer |
title_fullStr | NAMPT and NAPRT, Key Enzymes in NAD Salvage Synthesis Pathway, Are of Negative Prognostic Value in Colorectal Cancer |
title_full_unstemmed | NAMPT and NAPRT, Key Enzymes in NAD Salvage Synthesis Pathway, Are of Negative Prognostic Value in Colorectal Cancer |
title_short | NAMPT and NAPRT, Key Enzymes in NAD Salvage Synthesis Pathway, Are of Negative Prognostic Value in Colorectal Cancer |
title_sort | nampt and naprt, key enzymes in nad salvage synthesis pathway, are of negative prognostic value in colorectal cancer |
topic | Oncology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6691178/ https://www.ncbi.nlm.nih.gov/pubmed/31448236 http://dx.doi.org/10.3389/fonc.2019.00736 |
work_keys_str_mv | AT lixiaoqin namptandnaprtkeyenzymesinnadsalvagesynthesispathwayareofnegativeprognosticvalueincolorectalcancer AT leijing namptandnaprtkeyenzymesinnadsalvagesynthesispathwayareofnegativeprognosticvalueincolorectalcancer AT maolinhong namptandnaprtkeyenzymesinnadsalvagesynthesispathwayareofnegativeprognosticvalueincolorectalcancer AT wangqingliang namptandnaprtkeyenzymesinnadsalvagesynthesispathwayareofnegativeprognosticvalueincolorectalcancer AT xufeng namptandnaprtkeyenzymesinnadsalvagesynthesispathwayareofnegativeprognosticvalueincolorectalcancer AT rantao namptandnaprtkeyenzymesinnadsalvagesynthesispathwayareofnegativeprognosticvalueincolorectalcancer AT zhouzhihang namptandnaprtkeyenzymesinnadsalvagesynthesispathwayareofnegativeprognosticvalueincolorectalcancer AT hesong namptandnaprtkeyenzymesinnadsalvagesynthesispathwayareofnegativeprognosticvalueincolorectalcancer |