Cargando…

NAMPT and NAPRT, Key Enzymes in NAD Salvage Synthesis Pathway, Are of Negative Prognostic Value in Colorectal Cancer

Nicotinamide adenine dinucleotide (NAD) is a profoundly important cofactor in redox reactions. Nicotinamide phosphoribosyltransferase (NAMPT) and nicotinate phosphoribosyltransferase (NAPRT) are key enzymes for NAD salvage biosynthesis pathway, which reciprocally synthesize NAD to supply the main so...

Descripción completa

Detalles Bibliográficos
Autores principales: Li, Xiao-qin, Lei, Jing, Mao, Lin-hong, Wang, Qing-liang, Xu, Feng, Ran, Tao, Zhou, Zhi-hang, He, Song
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6691178/
https://www.ncbi.nlm.nih.gov/pubmed/31448236
http://dx.doi.org/10.3389/fonc.2019.00736
_version_ 1783443311932997632
author Li, Xiao-qin
Lei, Jing
Mao, Lin-hong
Wang, Qing-liang
Xu, Feng
Ran, Tao
Zhou, Zhi-hang
He, Song
author_facet Li, Xiao-qin
Lei, Jing
Mao, Lin-hong
Wang, Qing-liang
Xu, Feng
Ran, Tao
Zhou, Zhi-hang
He, Song
author_sort Li, Xiao-qin
collection PubMed
description Nicotinamide adenine dinucleotide (NAD) is a profoundly important cofactor in redox reactions. Nicotinamide phosphoribosyltransferase (NAMPT) and nicotinate phosphoribosyltransferase (NAPRT) are key enzymes for NAD salvage biosynthesis pathway, which reciprocally synthesize NAD to supply the main source of NAD biosythesis. However, the prognostic value of NAMPT and NAPRT in colorectal cancer (CRC) remains largely unknown. Our present study detected NAMPT and NAPRT protein expression in cancer and adjacent tissues from 261 CRC using immunohistochemical staining. We found that high expression of NAMPT or NAPRT was associated with vascular invasion, invasion depth and advanced TNM stage in CRC. High expression of NAMPT or NAPRT predicts short overall survival and disease-free survival time in CRC patients, which were further confirmed by public datasets. Furthermore, positive correlation between expression of NAMPT and NAPRT was revealed in CRC tissues and cell lines. NAPRT(high)/NAMPT(high) patients tended to have the shortest survival time. Using the TCGA RNA-sequencing data, we showed that gene amplification, mutation, and methylation of NAPRT are more common than NAMPT. On the other hand, NAMPT gene might be targeted by more miRNAs. Finally, genes that are correlated with NAPRT or NAMPT are enriched in different pathways. In conclusion, we found that high expression of NAMPT or NAPRT predicts poor prognosis of CRC patients, but the regulatory mechanism might be distinct from each other.
format Online
Article
Text
id pubmed-6691178
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-66911782019-08-23 NAMPT and NAPRT, Key Enzymes in NAD Salvage Synthesis Pathway, Are of Negative Prognostic Value in Colorectal Cancer Li, Xiao-qin Lei, Jing Mao, Lin-hong Wang, Qing-liang Xu, Feng Ran, Tao Zhou, Zhi-hang He, Song Front Oncol Oncology Nicotinamide adenine dinucleotide (NAD) is a profoundly important cofactor in redox reactions. Nicotinamide phosphoribosyltransferase (NAMPT) and nicotinate phosphoribosyltransferase (NAPRT) are key enzymes for NAD salvage biosynthesis pathway, which reciprocally synthesize NAD to supply the main source of NAD biosythesis. However, the prognostic value of NAMPT and NAPRT in colorectal cancer (CRC) remains largely unknown. Our present study detected NAMPT and NAPRT protein expression in cancer and adjacent tissues from 261 CRC using immunohistochemical staining. We found that high expression of NAMPT or NAPRT was associated with vascular invasion, invasion depth and advanced TNM stage in CRC. High expression of NAMPT or NAPRT predicts short overall survival and disease-free survival time in CRC patients, which were further confirmed by public datasets. Furthermore, positive correlation between expression of NAMPT and NAPRT was revealed in CRC tissues and cell lines. NAPRT(high)/NAMPT(high) patients tended to have the shortest survival time. Using the TCGA RNA-sequencing data, we showed that gene amplification, mutation, and methylation of NAPRT are more common than NAMPT. On the other hand, NAMPT gene might be targeted by more miRNAs. Finally, genes that are correlated with NAPRT or NAMPT are enriched in different pathways. In conclusion, we found that high expression of NAMPT or NAPRT predicts poor prognosis of CRC patients, but the regulatory mechanism might be distinct from each other. Frontiers Media S.A. 2019-08-06 /pmc/articles/PMC6691178/ /pubmed/31448236 http://dx.doi.org/10.3389/fonc.2019.00736 Text en Copyright © 2019 Li, Lei, Mao, Wang, Xu, Ran, Zhou and He. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Oncology
Li, Xiao-qin
Lei, Jing
Mao, Lin-hong
Wang, Qing-liang
Xu, Feng
Ran, Tao
Zhou, Zhi-hang
He, Song
NAMPT and NAPRT, Key Enzymes in NAD Salvage Synthesis Pathway, Are of Negative Prognostic Value in Colorectal Cancer
title NAMPT and NAPRT, Key Enzymes in NAD Salvage Synthesis Pathway, Are of Negative Prognostic Value in Colorectal Cancer
title_full NAMPT and NAPRT, Key Enzymes in NAD Salvage Synthesis Pathway, Are of Negative Prognostic Value in Colorectal Cancer
title_fullStr NAMPT and NAPRT, Key Enzymes in NAD Salvage Synthesis Pathway, Are of Negative Prognostic Value in Colorectal Cancer
title_full_unstemmed NAMPT and NAPRT, Key Enzymes in NAD Salvage Synthesis Pathway, Are of Negative Prognostic Value in Colorectal Cancer
title_short NAMPT and NAPRT, Key Enzymes in NAD Salvage Synthesis Pathway, Are of Negative Prognostic Value in Colorectal Cancer
title_sort nampt and naprt, key enzymes in nad salvage synthesis pathway, are of negative prognostic value in colorectal cancer
topic Oncology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6691178/
https://www.ncbi.nlm.nih.gov/pubmed/31448236
http://dx.doi.org/10.3389/fonc.2019.00736
work_keys_str_mv AT lixiaoqin namptandnaprtkeyenzymesinnadsalvagesynthesispathwayareofnegativeprognosticvalueincolorectalcancer
AT leijing namptandnaprtkeyenzymesinnadsalvagesynthesispathwayareofnegativeprognosticvalueincolorectalcancer
AT maolinhong namptandnaprtkeyenzymesinnadsalvagesynthesispathwayareofnegativeprognosticvalueincolorectalcancer
AT wangqingliang namptandnaprtkeyenzymesinnadsalvagesynthesispathwayareofnegativeprognosticvalueincolorectalcancer
AT xufeng namptandnaprtkeyenzymesinnadsalvagesynthesispathwayareofnegativeprognosticvalueincolorectalcancer
AT rantao namptandnaprtkeyenzymesinnadsalvagesynthesispathwayareofnegativeprognosticvalueincolorectalcancer
AT zhouzhihang namptandnaprtkeyenzymesinnadsalvagesynthesispathwayareofnegativeprognosticvalueincolorectalcancer
AT hesong namptandnaprtkeyenzymesinnadsalvagesynthesispathwayareofnegativeprognosticvalueincolorectalcancer