Cargando…
Acute Pannexin 1 Blockade Mitigates Early Synaptic Plasticity Defects in a Mouse Model of Alzheimer’s Disease
Synaptic loss induced by soluble oligomeric forms of the amyloid β peptide (sAβos) is one of the earliest events in Alzheimer’s disease (AD) and is thought to be the major cause of the cognitive deficits. These abnormalities rely on defects in synaptic plasticity, a series of events manifested as ac...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7103637/ https://www.ncbi.nlm.nih.gov/pubmed/32265655 http://dx.doi.org/10.3389/fncel.2020.00046 |
_version_ | 1783512090160398336 |
---|---|
author | Flores-Muñoz, Carolina Gómez, Bárbara Mery, Elena Mujica, Paula Gajardo, Ivana Córdova, Claudio Lopez-Espíndola, Daniela Durán-Aniotz, Claudia Hetz, Claudio Muñoz, Pablo Gonzalez-Jamett, Arlek M. Ardiles, Álvaro O. |
author_facet | Flores-Muñoz, Carolina Gómez, Bárbara Mery, Elena Mujica, Paula Gajardo, Ivana Córdova, Claudio Lopez-Espíndola, Daniela Durán-Aniotz, Claudia Hetz, Claudio Muñoz, Pablo Gonzalez-Jamett, Arlek M. Ardiles, Álvaro O. |
author_sort | Flores-Muñoz, Carolina |
collection | PubMed |
description | Synaptic loss induced by soluble oligomeric forms of the amyloid β peptide (sAβos) is one of the earliest events in Alzheimer’s disease (AD) and is thought to be the major cause of the cognitive deficits. These abnormalities rely on defects in synaptic plasticity, a series of events manifested as activity-dependent modifications in synaptic structure and function. It has been reported that pannexin 1 (Panx1), a nonselective channel implicated in cell communication and intracellular signaling, modulates the induction of excitatory synaptic plasticity under physiological contexts and contributes to neuronal death under inflammatory conditions. Here, we decided to study the involvement of Panx1 in functional and structural defects observed in excitatory synapses of the amyloid precursor protein (APP)/presenilin 1 (PS1) transgenic (Tg) mice, an animal model of AD. We found an age-dependent increase in the Panx1 expression that correlates with increased Aβ levels in hippocampal tissue from Tg mice. Congruently, we also observed an exacerbated Panx1 activity upon basal conditions and in response to glutamate receptor activation. The acute inhibition of Panx1 activity with the drug probenecid (PBN) did not change neurodegenerative parameters such as amyloid deposition or astrogliosis, but it significantly reduced excitatory synaptic defects in the AD model by normalizing long-term potentiation (LTP) and depression and improving dendritic arborization and spine density in hippocampal neurons of the Tg mice. These results suggest a major contribution of Panx1 in the early mechanisms leading to the synaptopathy in AD. Indeed, PBN induced a reduction in the activation of p38 mitogen-activated protein kinase (MAPK), a kinase widely implicated in the early neurotoxic signaling in AD. Our data strongly suggest that an enhanced expression and activation of Panx1 channels contribute to the Aβ-induced cascades leading to synaptic dysfunction in AD. |
format | Online Article Text |
id | pubmed-7103637 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-71036372020-04-07 Acute Pannexin 1 Blockade Mitigates Early Synaptic Plasticity Defects in a Mouse Model of Alzheimer’s Disease Flores-Muñoz, Carolina Gómez, Bárbara Mery, Elena Mujica, Paula Gajardo, Ivana Córdova, Claudio Lopez-Espíndola, Daniela Durán-Aniotz, Claudia Hetz, Claudio Muñoz, Pablo Gonzalez-Jamett, Arlek M. Ardiles, Álvaro O. Front Cell Neurosci Cellular Neuroscience Synaptic loss induced by soluble oligomeric forms of the amyloid β peptide (sAβos) is one of the earliest events in Alzheimer’s disease (AD) and is thought to be the major cause of the cognitive deficits. These abnormalities rely on defects in synaptic plasticity, a series of events manifested as activity-dependent modifications in synaptic structure and function. It has been reported that pannexin 1 (Panx1), a nonselective channel implicated in cell communication and intracellular signaling, modulates the induction of excitatory synaptic plasticity under physiological contexts and contributes to neuronal death under inflammatory conditions. Here, we decided to study the involvement of Panx1 in functional and structural defects observed in excitatory synapses of the amyloid precursor protein (APP)/presenilin 1 (PS1) transgenic (Tg) mice, an animal model of AD. We found an age-dependent increase in the Panx1 expression that correlates with increased Aβ levels in hippocampal tissue from Tg mice. Congruently, we also observed an exacerbated Panx1 activity upon basal conditions and in response to glutamate receptor activation. The acute inhibition of Panx1 activity with the drug probenecid (PBN) did not change neurodegenerative parameters such as amyloid deposition or astrogliosis, but it significantly reduced excitatory synaptic defects in the AD model by normalizing long-term potentiation (LTP) and depression and improving dendritic arborization and spine density in hippocampal neurons of the Tg mice. These results suggest a major contribution of Panx1 in the early mechanisms leading to the synaptopathy in AD. Indeed, PBN induced a reduction in the activation of p38 mitogen-activated protein kinase (MAPK), a kinase widely implicated in the early neurotoxic signaling in AD. Our data strongly suggest that an enhanced expression and activation of Panx1 channels contribute to the Aβ-induced cascades leading to synaptic dysfunction in AD. Frontiers Media S.A. 2020-03-19 /pmc/articles/PMC7103637/ /pubmed/32265655 http://dx.doi.org/10.3389/fncel.2020.00046 Text en Copyright © 2020 Flores-Muñoz, Gómez, Mery, Mujica, Gajardo, Córdova, Lopez-Espíndola, Durán-Aniotz, Hetz, Muñoz, Gonzalez-Jamett and Ardiles. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Cellular Neuroscience Flores-Muñoz, Carolina Gómez, Bárbara Mery, Elena Mujica, Paula Gajardo, Ivana Córdova, Claudio Lopez-Espíndola, Daniela Durán-Aniotz, Claudia Hetz, Claudio Muñoz, Pablo Gonzalez-Jamett, Arlek M. Ardiles, Álvaro O. Acute Pannexin 1 Blockade Mitigates Early Synaptic Plasticity Defects in a Mouse Model of Alzheimer’s Disease |
title | Acute Pannexin 1 Blockade Mitigates Early Synaptic Plasticity Defects in a Mouse Model of Alzheimer’s Disease |
title_full | Acute Pannexin 1 Blockade Mitigates Early Synaptic Plasticity Defects in a Mouse Model of Alzheimer’s Disease |
title_fullStr | Acute Pannexin 1 Blockade Mitigates Early Synaptic Plasticity Defects in a Mouse Model of Alzheimer’s Disease |
title_full_unstemmed | Acute Pannexin 1 Blockade Mitigates Early Synaptic Plasticity Defects in a Mouse Model of Alzheimer’s Disease |
title_short | Acute Pannexin 1 Blockade Mitigates Early Synaptic Plasticity Defects in a Mouse Model of Alzheimer’s Disease |
title_sort | acute pannexin 1 blockade mitigates early synaptic plasticity defects in a mouse model of alzheimer’s disease |
topic | Cellular Neuroscience |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7103637/ https://www.ncbi.nlm.nih.gov/pubmed/32265655 http://dx.doi.org/10.3389/fncel.2020.00046 |
work_keys_str_mv | AT floresmunozcarolina acutepannexin1blockademitigatesearlysynapticplasticitydefectsinamousemodelofalzheimersdisease AT gomezbarbara acutepannexin1blockademitigatesearlysynapticplasticitydefectsinamousemodelofalzheimersdisease AT meryelena acutepannexin1blockademitigatesearlysynapticplasticitydefectsinamousemodelofalzheimersdisease AT mujicapaula acutepannexin1blockademitigatesearlysynapticplasticitydefectsinamousemodelofalzheimersdisease AT gajardoivana acutepannexin1blockademitigatesearlysynapticplasticitydefectsinamousemodelofalzheimersdisease AT cordovaclaudio acutepannexin1blockademitigatesearlysynapticplasticitydefectsinamousemodelofalzheimersdisease AT lopezespindoladaniela acutepannexin1blockademitigatesearlysynapticplasticitydefectsinamousemodelofalzheimersdisease AT durananiotzclaudia acutepannexin1blockademitigatesearlysynapticplasticitydefectsinamousemodelofalzheimersdisease AT hetzclaudio acutepannexin1blockademitigatesearlysynapticplasticitydefectsinamousemodelofalzheimersdisease AT munozpablo acutepannexin1blockademitigatesearlysynapticplasticitydefectsinamousemodelofalzheimersdisease AT gonzalezjamettarlekm acutepannexin1blockademitigatesearlysynapticplasticitydefectsinamousemodelofalzheimersdisease AT ardilesalvaroo acutepannexin1blockademitigatesearlysynapticplasticitydefectsinamousemodelofalzheimersdisease |