Cargando…
Development of the pyruvate kinase deficiency diary and pyruvate kinase deficiency impact assessment: Disease‐specific assessments
INTRODUCTION: Currently recommended patient‐reported outcome (PRO) measures for patients with pyruvate kinase (PK) deficiency are non‐disease‐specific. The PK Deficiency Diary (PKDD) and PK Deficiency Impact Assessment (PKDIA) were developed to be more targeted measures for capturing the symptoms an...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
John Wiley and Sons Inc.
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7216839/ https://www.ncbi.nlm.nih.gov/pubmed/31880847 http://dx.doi.org/10.1111/ejh.13376 |
_version_ | 1783532491294900224 |
---|---|
author | Salek, Sam Boscoe, Audra N. Piantedosi, Sarah Egan, Shayna Evans, Christopher J Wells, Ted Cohen, Jennifer Klaassen, Robert J. Grace, Rachael Storm, Michael |
author_facet | Salek, Sam Boscoe, Audra N. Piantedosi, Sarah Egan, Shayna Evans, Christopher J Wells, Ted Cohen, Jennifer Klaassen, Robert J. Grace, Rachael Storm, Michael |
author_sort | Salek, Sam |
collection | PubMed |
description | INTRODUCTION: Currently recommended patient‐reported outcome (PRO) measures for patients with pyruvate kinase (PK) deficiency are non‐disease‐specific. The PK Deficiency Diary (PKDD) and PK Deficiency Impact Assessment (PKDIA) were developed to be more targeted measures for capturing the symptoms and impacts of interest to this patient population. METHODS: The instruments were developed based on concept elicitation interviews with 21 adults and modified based on 20 cognitive interviews. The domain structure and item concepts of the PKDD and PKDIA were compared with currently recommended measures, the EORTC QLQ‐C30 and the SF‐36v2®. RESULTS: The PKDD is a seven‐item measure of the core signs and symptoms of PK deficiency. The PKDIA is a 14‐item measure of the impacts of PK deficiency on patients’ health‐related quality of life (HRQoL). Minimal similarities were found between the new measures and the EORTC QLQ‐C30 (eg, 43% of concepts were similar to the PKDD; 42% were similar to the PKDIA) and SF‐36v2® (57% of concepts were similar to the PKDD; 17% were similar to the PKDIA). CONCLUSIONS: The PKDD and PKDIA fill a gap in the existing outcomes measurement strategy for PK deficiency. Future work includes psychometric evaluation of these newly developed measures. |
format | Online Article Text |
id | pubmed-7216839 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | John Wiley and Sons Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-72168392020-05-13 Development of the pyruvate kinase deficiency diary and pyruvate kinase deficiency impact assessment: Disease‐specific assessments Salek, Sam Boscoe, Audra N. Piantedosi, Sarah Egan, Shayna Evans, Christopher J Wells, Ted Cohen, Jennifer Klaassen, Robert J. Grace, Rachael Storm, Michael Eur J Haematol Original Articles INTRODUCTION: Currently recommended patient‐reported outcome (PRO) measures for patients with pyruvate kinase (PK) deficiency are non‐disease‐specific. The PK Deficiency Diary (PKDD) and PK Deficiency Impact Assessment (PKDIA) were developed to be more targeted measures for capturing the symptoms and impacts of interest to this patient population. METHODS: The instruments were developed based on concept elicitation interviews with 21 adults and modified based on 20 cognitive interviews. The domain structure and item concepts of the PKDD and PKDIA were compared with currently recommended measures, the EORTC QLQ‐C30 and the SF‐36v2®. RESULTS: The PKDD is a seven‐item measure of the core signs and symptoms of PK deficiency. The PKDIA is a 14‐item measure of the impacts of PK deficiency on patients’ health‐related quality of life (HRQoL). Minimal similarities were found between the new measures and the EORTC QLQ‐C30 (eg, 43% of concepts were similar to the PKDD; 42% were similar to the PKDIA) and SF‐36v2® (57% of concepts were similar to the PKDD; 17% were similar to the PKDIA). CONCLUSIONS: The PKDD and PKDIA fill a gap in the existing outcomes measurement strategy for PK deficiency. Future work includes psychometric evaluation of these newly developed measures. John Wiley and Sons Inc. 2020-02-24 2020-05 /pmc/articles/PMC7216839/ /pubmed/31880847 http://dx.doi.org/10.1111/ejh.13376 Text en © 2019 Agios Pharmaceuticals Inc. European Journal of Haematology Published by John Wiley & Sons Ltd This is an open access article under the terms of the http://creativecommons.org/licenses/by-nc-nd/4.0/ License, which permits use and distribution in any medium, provided the original work is properly cited, the use is non‐commercial and no modifications or adaptations are made. |
spellingShingle | Original Articles Salek, Sam Boscoe, Audra N. Piantedosi, Sarah Egan, Shayna Evans, Christopher J Wells, Ted Cohen, Jennifer Klaassen, Robert J. Grace, Rachael Storm, Michael Development of the pyruvate kinase deficiency diary and pyruvate kinase deficiency impact assessment: Disease‐specific assessments |
title | Development of the pyruvate kinase deficiency diary and pyruvate kinase deficiency impact assessment: Disease‐specific assessments |
title_full | Development of the pyruvate kinase deficiency diary and pyruvate kinase deficiency impact assessment: Disease‐specific assessments |
title_fullStr | Development of the pyruvate kinase deficiency diary and pyruvate kinase deficiency impact assessment: Disease‐specific assessments |
title_full_unstemmed | Development of the pyruvate kinase deficiency diary and pyruvate kinase deficiency impact assessment: Disease‐specific assessments |
title_short | Development of the pyruvate kinase deficiency diary and pyruvate kinase deficiency impact assessment: Disease‐specific assessments |
title_sort | development of the pyruvate kinase deficiency diary and pyruvate kinase deficiency impact assessment: disease‐specific assessments |
topic | Original Articles |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7216839/ https://www.ncbi.nlm.nih.gov/pubmed/31880847 http://dx.doi.org/10.1111/ejh.13376 |
work_keys_str_mv | AT saleksam developmentofthepyruvatekinasedeficiencydiaryandpyruvatekinasedeficiencyimpactassessmentdiseasespecificassessments AT boscoeaudran developmentofthepyruvatekinasedeficiencydiaryandpyruvatekinasedeficiencyimpactassessmentdiseasespecificassessments AT piantedosisarah developmentofthepyruvatekinasedeficiencydiaryandpyruvatekinasedeficiencyimpactassessmentdiseasespecificassessments AT eganshayna developmentofthepyruvatekinasedeficiencydiaryandpyruvatekinasedeficiencyimpactassessmentdiseasespecificassessments AT evanschristopherj developmentofthepyruvatekinasedeficiencydiaryandpyruvatekinasedeficiencyimpactassessmentdiseasespecificassessments AT wellsted developmentofthepyruvatekinasedeficiencydiaryandpyruvatekinasedeficiencyimpactassessmentdiseasespecificassessments AT cohenjennifer developmentofthepyruvatekinasedeficiencydiaryandpyruvatekinasedeficiencyimpactassessmentdiseasespecificassessments AT klaassenrobertj developmentofthepyruvatekinasedeficiencydiaryandpyruvatekinasedeficiencyimpactassessmentdiseasespecificassessments AT gracerachael developmentofthepyruvatekinasedeficiencydiaryandpyruvatekinasedeficiencyimpactassessmentdiseasespecificassessments AT stormmichael developmentofthepyruvatekinasedeficiencydiaryandpyruvatekinasedeficiencyimpactassessmentdiseasespecificassessments |