Cargando…
Plasma Trans Fatty Acid Levels, Cardiovascular Risk Factors and Lifestyle: Results from the Akershus Cardiac Examination 1950 Study
Intake of industrially produced trans fatty acids (iTFAs) has previously been associated with dyslipidemia, insulin resistance, hypertension and inflammation, as well as increased cardiovascular (CV) morbidity and mortality. iTFA intake declined in Norway after the introduction of legislative bans a...
Autores principales: | , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7284775/ https://www.ncbi.nlm.nih.gov/pubmed/32423040 http://dx.doi.org/10.3390/nu12051419 |
_version_ | 1783544546739617792 |
---|---|
author | Chandra, Anupam Lyngbakken, Magnus Nakrem Eide, Ivar Anders Røsjø, Helge Vigen, Thea Ihle-Hansen, Håkon Orstad, Eivind Bjørkan Rønning, Ole Morten Berge, Trygve Schmidt, Erik Berg Tveit, Arnljot Omland, Torbjørn Svensson, My |
author_facet | Chandra, Anupam Lyngbakken, Magnus Nakrem Eide, Ivar Anders Røsjø, Helge Vigen, Thea Ihle-Hansen, Håkon Orstad, Eivind Bjørkan Rønning, Ole Morten Berge, Trygve Schmidt, Erik Berg Tveit, Arnljot Omland, Torbjørn Svensson, My |
author_sort | Chandra, Anupam |
collection | PubMed |
description | Intake of industrially produced trans fatty acids (iTFAs) has previously been associated with dyslipidemia, insulin resistance, hypertension and inflammation, as well as increased cardiovascular (CV) morbidity and mortality. iTFA intake declined in Norway after the introduction of legislative bans against iTFA consumption. However, the relationship between the current iTFA intake and CV health is unclear. The aim of the present study was to investigate the association between current iTFA intake, reflected by plasma iTFA levels, and established CV risk factors. We also examined the associations between plasma ruminant TFA levels and CV risk factors. In this cross-sectional study, we included 3706 participants from a Norwegian general population, born in 1950 and residing in Akershus County, Norway. The statistical method was multivariable linear regression. Plasma iTFA levels were inversely associated with serum triglycerides (p < 0.001), fasting plasma glucose (p < 0.001), body mass index (p < 0.001), systolic and diastolic blood pressure (p = 0.001 and p = 0.03) and C-reactive protein (p = 0.001). Furthermore, high plasma iTFA levels were associated with higher education and less smoking and alcohol consumption. We found that plasma ruminant trans fatty acids (rTFA) levels were favorably associated with CV risk factors. Furthermore, plasma iTFA levels were inversely associated with CV risk factors. However, our results might have been driven by lifestyle factors. Overall, our findings suggest that the current low intake of iTFAs in Norway does not constitute a threat to CV health. |
format | Online Article Text |
id | pubmed-7284775 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-72847752020-06-15 Plasma Trans Fatty Acid Levels, Cardiovascular Risk Factors and Lifestyle: Results from the Akershus Cardiac Examination 1950 Study Chandra, Anupam Lyngbakken, Magnus Nakrem Eide, Ivar Anders Røsjø, Helge Vigen, Thea Ihle-Hansen, Håkon Orstad, Eivind Bjørkan Rønning, Ole Morten Berge, Trygve Schmidt, Erik Berg Tveit, Arnljot Omland, Torbjørn Svensson, My Nutrients Article Intake of industrially produced trans fatty acids (iTFAs) has previously been associated with dyslipidemia, insulin resistance, hypertension and inflammation, as well as increased cardiovascular (CV) morbidity and mortality. iTFA intake declined in Norway after the introduction of legislative bans against iTFA consumption. However, the relationship between the current iTFA intake and CV health is unclear. The aim of the present study was to investigate the association between current iTFA intake, reflected by plasma iTFA levels, and established CV risk factors. We also examined the associations between plasma ruminant TFA levels and CV risk factors. In this cross-sectional study, we included 3706 participants from a Norwegian general population, born in 1950 and residing in Akershus County, Norway. The statistical method was multivariable linear regression. Plasma iTFA levels were inversely associated with serum triglycerides (p < 0.001), fasting plasma glucose (p < 0.001), body mass index (p < 0.001), systolic and diastolic blood pressure (p = 0.001 and p = 0.03) and C-reactive protein (p = 0.001). Furthermore, high plasma iTFA levels were associated with higher education and less smoking and alcohol consumption. We found that plasma ruminant trans fatty acids (rTFA) levels were favorably associated with CV risk factors. Furthermore, plasma iTFA levels were inversely associated with CV risk factors. However, our results might have been driven by lifestyle factors. Overall, our findings suggest that the current low intake of iTFAs in Norway does not constitute a threat to CV health. MDPI 2020-05-14 /pmc/articles/PMC7284775/ /pubmed/32423040 http://dx.doi.org/10.3390/nu12051419 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Chandra, Anupam Lyngbakken, Magnus Nakrem Eide, Ivar Anders Røsjø, Helge Vigen, Thea Ihle-Hansen, Håkon Orstad, Eivind Bjørkan Rønning, Ole Morten Berge, Trygve Schmidt, Erik Berg Tveit, Arnljot Omland, Torbjørn Svensson, My Plasma Trans Fatty Acid Levels, Cardiovascular Risk Factors and Lifestyle: Results from the Akershus Cardiac Examination 1950 Study |
title | Plasma Trans Fatty Acid Levels, Cardiovascular Risk Factors and Lifestyle: Results from the Akershus Cardiac Examination 1950 Study |
title_full | Plasma Trans Fatty Acid Levels, Cardiovascular Risk Factors and Lifestyle: Results from the Akershus Cardiac Examination 1950 Study |
title_fullStr | Plasma Trans Fatty Acid Levels, Cardiovascular Risk Factors and Lifestyle: Results from the Akershus Cardiac Examination 1950 Study |
title_full_unstemmed | Plasma Trans Fatty Acid Levels, Cardiovascular Risk Factors and Lifestyle: Results from the Akershus Cardiac Examination 1950 Study |
title_short | Plasma Trans Fatty Acid Levels, Cardiovascular Risk Factors and Lifestyle: Results from the Akershus Cardiac Examination 1950 Study |
title_sort | plasma trans fatty acid levels, cardiovascular risk factors and lifestyle: results from the akershus cardiac examination 1950 study |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7284775/ https://www.ncbi.nlm.nih.gov/pubmed/32423040 http://dx.doi.org/10.3390/nu12051419 |
work_keys_str_mv | AT chandraanupam plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study AT lyngbakkenmagnusnakrem plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study AT eideivaranders plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study AT røsjøhelge plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study AT vigenthea plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study AT ihlehansenhakon plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study AT orstadeivindbjørkan plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study AT rønningolemorten plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study AT bergetrygve plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study AT schmidterikberg plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study AT tveitarnljot plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study AT omlandtorbjørn plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study AT svenssonmy plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study |