Cargando…

Plasma Trans Fatty Acid Levels, Cardiovascular Risk Factors and Lifestyle: Results from the Akershus Cardiac Examination 1950 Study

Intake of industrially produced trans fatty acids (iTFAs) has previously been associated with dyslipidemia, insulin resistance, hypertension and inflammation, as well as increased cardiovascular (CV) morbidity and mortality. iTFA intake declined in Norway after the introduction of legislative bans a...

Descripción completa

Detalles Bibliográficos
Autores principales: Chandra, Anupam, Lyngbakken, Magnus Nakrem, Eide, Ivar Anders, Røsjø, Helge, Vigen, Thea, Ihle-Hansen, Håkon, Orstad, Eivind Bjørkan, Rønning, Ole Morten, Berge, Trygve, Schmidt, Erik Berg, Tveit, Arnljot, Omland, Torbjørn, Svensson, My
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7284775/
https://www.ncbi.nlm.nih.gov/pubmed/32423040
http://dx.doi.org/10.3390/nu12051419
_version_ 1783544546739617792
author Chandra, Anupam
Lyngbakken, Magnus Nakrem
Eide, Ivar Anders
Røsjø, Helge
Vigen, Thea
Ihle-Hansen, Håkon
Orstad, Eivind Bjørkan
Rønning, Ole Morten
Berge, Trygve
Schmidt, Erik Berg
Tveit, Arnljot
Omland, Torbjørn
Svensson, My
author_facet Chandra, Anupam
Lyngbakken, Magnus Nakrem
Eide, Ivar Anders
Røsjø, Helge
Vigen, Thea
Ihle-Hansen, Håkon
Orstad, Eivind Bjørkan
Rønning, Ole Morten
Berge, Trygve
Schmidt, Erik Berg
Tveit, Arnljot
Omland, Torbjørn
Svensson, My
author_sort Chandra, Anupam
collection PubMed
description Intake of industrially produced trans fatty acids (iTFAs) has previously been associated with dyslipidemia, insulin resistance, hypertension and inflammation, as well as increased cardiovascular (CV) morbidity and mortality. iTFA intake declined in Norway after the introduction of legislative bans against iTFA consumption. However, the relationship between the current iTFA intake and CV health is unclear. The aim of the present study was to investigate the association between current iTFA intake, reflected by plasma iTFA levels, and established CV risk factors. We also examined the associations between plasma ruminant TFA levels and CV risk factors. In this cross-sectional study, we included 3706 participants from a Norwegian general population, born in 1950 and residing in Akershus County, Norway. The statistical method was multivariable linear regression. Plasma iTFA levels were inversely associated with serum triglycerides (p < 0.001), fasting plasma glucose (p < 0.001), body mass index (p < 0.001), systolic and diastolic blood pressure (p = 0.001 and p = 0.03) and C-reactive protein (p = 0.001). Furthermore, high plasma iTFA levels were associated with higher education and less smoking and alcohol consumption. We found that plasma ruminant trans fatty acids (rTFA) levels were favorably associated with CV risk factors. Furthermore, plasma iTFA levels were inversely associated with CV risk factors. However, our results might have been driven by lifestyle factors. Overall, our findings suggest that the current low intake of iTFAs in Norway does not constitute a threat to CV health.
format Online
Article
Text
id pubmed-7284775
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-72847752020-06-15 Plasma Trans Fatty Acid Levels, Cardiovascular Risk Factors and Lifestyle: Results from the Akershus Cardiac Examination 1950 Study Chandra, Anupam Lyngbakken, Magnus Nakrem Eide, Ivar Anders Røsjø, Helge Vigen, Thea Ihle-Hansen, Håkon Orstad, Eivind Bjørkan Rønning, Ole Morten Berge, Trygve Schmidt, Erik Berg Tveit, Arnljot Omland, Torbjørn Svensson, My Nutrients Article Intake of industrially produced trans fatty acids (iTFAs) has previously been associated with dyslipidemia, insulin resistance, hypertension and inflammation, as well as increased cardiovascular (CV) morbidity and mortality. iTFA intake declined in Norway after the introduction of legislative bans against iTFA consumption. However, the relationship between the current iTFA intake and CV health is unclear. The aim of the present study was to investigate the association between current iTFA intake, reflected by plasma iTFA levels, and established CV risk factors. We also examined the associations between plasma ruminant TFA levels and CV risk factors. In this cross-sectional study, we included 3706 participants from a Norwegian general population, born in 1950 and residing in Akershus County, Norway. The statistical method was multivariable linear regression. Plasma iTFA levels were inversely associated with serum triglycerides (p < 0.001), fasting plasma glucose (p < 0.001), body mass index (p < 0.001), systolic and diastolic blood pressure (p = 0.001 and p = 0.03) and C-reactive protein (p = 0.001). Furthermore, high plasma iTFA levels were associated with higher education and less smoking and alcohol consumption. We found that plasma ruminant trans fatty acids (rTFA) levels were favorably associated with CV risk factors. Furthermore, plasma iTFA levels were inversely associated with CV risk factors. However, our results might have been driven by lifestyle factors. Overall, our findings suggest that the current low intake of iTFAs in Norway does not constitute a threat to CV health. MDPI 2020-05-14 /pmc/articles/PMC7284775/ /pubmed/32423040 http://dx.doi.org/10.3390/nu12051419 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Chandra, Anupam
Lyngbakken, Magnus Nakrem
Eide, Ivar Anders
Røsjø, Helge
Vigen, Thea
Ihle-Hansen, Håkon
Orstad, Eivind Bjørkan
Rønning, Ole Morten
Berge, Trygve
Schmidt, Erik Berg
Tveit, Arnljot
Omland, Torbjørn
Svensson, My
Plasma Trans Fatty Acid Levels, Cardiovascular Risk Factors and Lifestyle: Results from the Akershus Cardiac Examination 1950 Study
title Plasma Trans Fatty Acid Levels, Cardiovascular Risk Factors and Lifestyle: Results from the Akershus Cardiac Examination 1950 Study
title_full Plasma Trans Fatty Acid Levels, Cardiovascular Risk Factors and Lifestyle: Results from the Akershus Cardiac Examination 1950 Study
title_fullStr Plasma Trans Fatty Acid Levels, Cardiovascular Risk Factors and Lifestyle: Results from the Akershus Cardiac Examination 1950 Study
title_full_unstemmed Plasma Trans Fatty Acid Levels, Cardiovascular Risk Factors and Lifestyle: Results from the Akershus Cardiac Examination 1950 Study
title_short Plasma Trans Fatty Acid Levels, Cardiovascular Risk Factors and Lifestyle: Results from the Akershus Cardiac Examination 1950 Study
title_sort plasma trans fatty acid levels, cardiovascular risk factors and lifestyle: results from the akershus cardiac examination 1950 study
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7284775/
https://www.ncbi.nlm.nih.gov/pubmed/32423040
http://dx.doi.org/10.3390/nu12051419
work_keys_str_mv AT chandraanupam plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study
AT lyngbakkenmagnusnakrem plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study
AT eideivaranders plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study
AT røsjøhelge plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study
AT vigenthea plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study
AT ihlehansenhakon plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study
AT orstadeivindbjørkan plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study
AT rønningolemorten plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study
AT bergetrygve plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study
AT schmidterikberg plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study
AT tveitarnljot plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study
AT omlandtorbjørn plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study
AT svenssonmy plasmatransfattyacidlevelscardiovascularriskfactorsandlifestyleresultsfromtheakershuscardiacexamination1950study