Cargando…

A Vaccine Displaying a Trimeric Influenza-A HA Stem Protein on Capsid-Like Particles Elicits Potent and Long-Lasting Protection in Mice

Due to constant antigenic drift and shift, current influenza-A vaccines need to be redesigned and administered annually. A universal flu vaccine (UFV) that provides long-lasting protection against both seasonal and emerging pandemic influenza strains is thus urgently needed. The hemagglutinin (HA) s...

Descripción completa

Detalles Bibliográficos
Autores principales: Thrane, Susan, Aves, Kara-Lee, Uddbäck, Ida E. M, Janitzek, Christoph M., Han, Julianna, Yang, Yuhe R., Ward, Andrew B., Theander, Thor G., Nielsen, Morten A., Salanti, Ali, Thomsen, Allan R., Christensen, Jan P., Sander, Adam F.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7564254/
https://www.ncbi.nlm.nih.gov/pubmed/32679905
http://dx.doi.org/10.3390/vaccines8030389
_version_ 1783595672058986496
author Thrane, Susan
Aves, Kara-Lee
Uddbäck, Ida E. M
Janitzek, Christoph M.
Han, Julianna
Yang, Yuhe R.
Ward, Andrew B.
Theander, Thor G.
Nielsen, Morten A.
Salanti, Ali
Thomsen, Allan R.
Christensen, Jan P.
Sander, Adam F.
author_facet Thrane, Susan
Aves, Kara-Lee
Uddbäck, Ida E. M
Janitzek, Christoph M.
Han, Julianna
Yang, Yuhe R.
Ward, Andrew B.
Theander, Thor G.
Nielsen, Morten A.
Salanti, Ali
Thomsen, Allan R.
Christensen, Jan P.
Sander, Adam F.
author_sort Thrane, Susan
collection PubMed
description Due to constant antigenic drift and shift, current influenza-A vaccines need to be redesigned and administered annually. A universal flu vaccine (UFV) that provides long-lasting protection against both seasonal and emerging pandemic influenza strains is thus urgently needed. The hemagglutinin (HA) stem antigen is a promising target for such a vaccine as it contains neutralizing epitopes, known to induce cross-protective IgG responses against a wide variety of influenza subtypes. In this study, we describe the development of a UFV candidate consisting of a HA(stem) trimer displayed on the surface of rigid capsid-like particles (CLP). Compared to soluble unconjugated HA(stem) trimer, the CLP-HA(stem) particles induced a more potent, long-lasting immune response and were able to protect mice against both homologous and heterologous H1N1 influenza challenge, even after a single dose.
format Online
Article
Text
id pubmed-7564254
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-75642542020-10-26 A Vaccine Displaying a Trimeric Influenza-A HA Stem Protein on Capsid-Like Particles Elicits Potent and Long-Lasting Protection in Mice Thrane, Susan Aves, Kara-Lee Uddbäck, Ida E. M Janitzek, Christoph M. Han, Julianna Yang, Yuhe R. Ward, Andrew B. Theander, Thor G. Nielsen, Morten A. Salanti, Ali Thomsen, Allan R. Christensen, Jan P. Sander, Adam F. Vaccines (Basel) Article Due to constant antigenic drift and shift, current influenza-A vaccines need to be redesigned and administered annually. A universal flu vaccine (UFV) that provides long-lasting protection against both seasonal and emerging pandemic influenza strains is thus urgently needed. The hemagglutinin (HA) stem antigen is a promising target for such a vaccine as it contains neutralizing epitopes, known to induce cross-protective IgG responses against a wide variety of influenza subtypes. In this study, we describe the development of a UFV candidate consisting of a HA(stem) trimer displayed on the surface of rigid capsid-like particles (CLP). Compared to soluble unconjugated HA(stem) trimer, the CLP-HA(stem) particles induced a more potent, long-lasting immune response and were able to protect mice against both homologous and heterologous H1N1 influenza challenge, even after a single dose. MDPI 2020-07-15 /pmc/articles/PMC7564254/ /pubmed/32679905 http://dx.doi.org/10.3390/vaccines8030389 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Thrane, Susan
Aves, Kara-Lee
Uddbäck, Ida E. M
Janitzek, Christoph M.
Han, Julianna
Yang, Yuhe R.
Ward, Andrew B.
Theander, Thor G.
Nielsen, Morten A.
Salanti, Ali
Thomsen, Allan R.
Christensen, Jan P.
Sander, Adam F.
A Vaccine Displaying a Trimeric Influenza-A HA Stem Protein on Capsid-Like Particles Elicits Potent and Long-Lasting Protection in Mice
title A Vaccine Displaying a Trimeric Influenza-A HA Stem Protein on Capsid-Like Particles Elicits Potent and Long-Lasting Protection in Mice
title_full A Vaccine Displaying a Trimeric Influenza-A HA Stem Protein on Capsid-Like Particles Elicits Potent and Long-Lasting Protection in Mice
title_fullStr A Vaccine Displaying a Trimeric Influenza-A HA Stem Protein on Capsid-Like Particles Elicits Potent and Long-Lasting Protection in Mice
title_full_unstemmed A Vaccine Displaying a Trimeric Influenza-A HA Stem Protein on Capsid-Like Particles Elicits Potent and Long-Lasting Protection in Mice
title_short A Vaccine Displaying a Trimeric Influenza-A HA Stem Protein on Capsid-Like Particles Elicits Potent and Long-Lasting Protection in Mice
title_sort vaccine displaying a trimeric influenza-a ha stem protein on capsid-like particles elicits potent and long-lasting protection in mice
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7564254/
https://www.ncbi.nlm.nih.gov/pubmed/32679905
http://dx.doi.org/10.3390/vaccines8030389
work_keys_str_mv AT thranesusan avaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT aveskaralee avaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT uddbackidaem avaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT janitzekchristophm avaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT hanjulianna avaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT yangyuher avaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT wardandrewb avaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT theanderthorg avaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT nielsenmortena avaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT salantiali avaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT thomsenallanr avaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT christensenjanp avaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT sanderadamf avaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT thranesusan vaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT aveskaralee vaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT uddbackidaem vaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT janitzekchristophm vaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT hanjulianna vaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT yangyuher vaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT wardandrewb vaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT theanderthorg vaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT nielsenmortena vaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT salantiali vaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT thomsenallanr vaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT christensenjanp vaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice
AT sanderadamf vaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice