Cargando…
An evaluation of service user experience, clinical outcomes and service use associated with urgent care services that utilise telephone-based digital triage: a systematic review protocol
BACKGROUND: Telephone-based digital triage is widely used by services that provide urgent care. This involves a call handler or clinician using a digital triage tool to generate algorithm-based care advice, based on a patient’s symptoms. Advice typically takes the form of signposting within defined...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7805218/ https://www.ncbi.nlm.nih.gov/pubmed/33441189 http://dx.doi.org/10.1186/s13643-021-01576-x |
_version_ | 1783636275921682432 |
---|---|
author | Sexton, Vanashree Dale, Jeremy Atherton, Helen |
author_facet | Sexton, Vanashree Dale, Jeremy Atherton, Helen |
author_sort | Sexton, Vanashree |
collection | PubMed |
description | BACKGROUND: Telephone-based digital triage is widely used by services that provide urgent care. This involves a call handler or clinician using a digital triage tool to generate algorithm-based care advice, based on a patient’s symptoms. Advice typically takes the form of signposting within defined levels of urgency to specific services or self-care advice. Despite wide adoption, there is limited evaluation of its impact on service user experience, service use and clinical outcomes; no previous systematic reviews have focussed on services that utilise digital triage, and its impact on these outcome areas within urgent care. This review aims to address this need, particularly now that telephone-based digital triage is well established in healthcare delivery. METHODS: Studies assessing the impact of telephone-based digital triage on service user experience, health care service use and clinical outcomes will be identified through searches conducted in Medline, Embase, Cumulative Index to Nursing and Allied Health Literature (CINAHL), Web of Science and Scopus. Search terms using words relating to digital triage and urgent care settings (excluding in-hours general practice) will be used. The review will include all original study types including qualitative, quantitative and mixed methods studies; studies published in the last 20 years and studies published in English. Quality assessment of studies will be conducted using the Mixed Methods Appraisal Tool (MMAT); a narrative synthesis approach will be used to analyse and summarise findings. DISCUSSION: This is the first systematic review to evaluate service user experience, service use and clinical outcomes related to the use of telephone-based digital triage in urgent care settings. It will evaluate evidence from studies of wide-ranging designs. The narrative synthesis approach will enable the integration of findings to provide new insights on service delivery. Models of urgent care continue to evolve rapidly, with the emergence of self-triage tools and national help lines. Findings from this review will be presented in a practical format that can feed into the design of digital triage tools, future service design and healthcare policy. SYSTEMATIC REVIEW REGISTRATION: This systematic review is registered on the international database of prospectively registered systematic reviews in health and social care (PROSPERO 2020 CRD42020178500). SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13643-021-01576-x. |
format | Online Article Text |
id | pubmed-7805218 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-78052182021-01-14 An evaluation of service user experience, clinical outcomes and service use associated with urgent care services that utilise telephone-based digital triage: a systematic review protocol Sexton, Vanashree Dale, Jeremy Atherton, Helen Syst Rev Protocol BACKGROUND: Telephone-based digital triage is widely used by services that provide urgent care. This involves a call handler or clinician using a digital triage tool to generate algorithm-based care advice, based on a patient’s symptoms. Advice typically takes the form of signposting within defined levels of urgency to specific services or self-care advice. Despite wide adoption, there is limited evaluation of its impact on service user experience, service use and clinical outcomes; no previous systematic reviews have focussed on services that utilise digital triage, and its impact on these outcome areas within urgent care. This review aims to address this need, particularly now that telephone-based digital triage is well established in healthcare delivery. METHODS: Studies assessing the impact of telephone-based digital triage on service user experience, health care service use and clinical outcomes will be identified through searches conducted in Medline, Embase, Cumulative Index to Nursing and Allied Health Literature (CINAHL), Web of Science and Scopus. Search terms using words relating to digital triage and urgent care settings (excluding in-hours general practice) will be used. The review will include all original study types including qualitative, quantitative and mixed methods studies; studies published in the last 20 years and studies published in English. Quality assessment of studies will be conducted using the Mixed Methods Appraisal Tool (MMAT); a narrative synthesis approach will be used to analyse and summarise findings. DISCUSSION: This is the first systematic review to evaluate service user experience, service use and clinical outcomes related to the use of telephone-based digital triage in urgent care settings. It will evaluate evidence from studies of wide-ranging designs. The narrative synthesis approach will enable the integration of findings to provide new insights on service delivery. Models of urgent care continue to evolve rapidly, with the emergence of self-triage tools and national help lines. Findings from this review will be presented in a practical format that can feed into the design of digital triage tools, future service design and healthcare policy. SYSTEMATIC REVIEW REGISTRATION: This systematic review is registered on the international database of prospectively registered systematic reviews in health and social care (PROSPERO 2020 CRD42020178500). SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13643-021-01576-x. BioMed Central 2021-01-13 /pmc/articles/PMC7805218/ /pubmed/33441189 http://dx.doi.org/10.1186/s13643-021-01576-x Text en © The Author(s) 2021 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Protocol Sexton, Vanashree Dale, Jeremy Atherton, Helen An evaluation of service user experience, clinical outcomes and service use associated with urgent care services that utilise telephone-based digital triage: a systematic review protocol |
title | An evaluation of service user experience, clinical outcomes and service use associated with urgent care services that utilise telephone-based digital triage: a systematic review protocol |
title_full | An evaluation of service user experience, clinical outcomes and service use associated with urgent care services that utilise telephone-based digital triage: a systematic review protocol |
title_fullStr | An evaluation of service user experience, clinical outcomes and service use associated with urgent care services that utilise telephone-based digital triage: a systematic review protocol |
title_full_unstemmed | An evaluation of service user experience, clinical outcomes and service use associated with urgent care services that utilise telephone-based digital triage: a systematic review protocol |
title_short | An evaluation of service user experience, clinical outcomes and service use associated with urgent care services that utilise telephone-based digital triage: a systematic review protocol |
title_sort | evaluation of service user experience, clinical outcomes and service use associated with urgent care services that utilise telephone-based digital triage: a systematic review protocol |
topic | Protocol |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7805218/ https://www.ncbi.nlm.nih.gov/pubmed/33441189 http://dx.doi.org/10.1186/s13643-021-01576-x |
work_keys_str_mv | AT sextonvanashree anevaluationofserviceuserexperienceclinicaloutcomesandserviceuseassociatedwithurgentcareservicesthatutilisetelephonebaseddigitaltriageasystematicreviewprotocol AT dalejeremy anevaluationofserviceuserexperienceclinicaloutcomesandserviceuseassociatedwithurgentcareservicesthatutilisetelephonebaseddigitaltriageasystematicreviewprotocol AT athertonhelen anevaluationofserviceuserexperienceclinicaloutcomesandserviceuseassociatedwithurgentcareservicesthatutilisetelephonebaseddigitaltriageasystematicreviewprotocol AT sextonvanashree evaluationofserviceuserexperienceclinicaloutcomesandserviceuseassociatedwithurgentcareservicesthatutilisetelephonebaseddigitaltriageasystematicreviewprotocol AT dalejeremy evaluationofserviceuserexperienceclinicaloutcomesandserviceuseassociatedwithurgentcareservicesthatutilisetelephonebaseddigitaltriageasystematicreviewprotocol AT athertonhelen evaluationofserviceuserexperienceclinicaloutcomesandserviceuseassociatedwithurgentcareservicesthatutilisetelephonebaseddigitaltriageasystematicreviewprotocol |