Cargando…
Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes
Allergic reactions occur when IgE molecules become crosslinked by antigens such as food proteins. Here we create the ‘AllerScan’ programmable phage display system to characterize the binding specificities of anti-allergen IgG and IgE antibodies in serum against thousands of allergenic proteins from...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group UK
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7822912/ https://www.ncbi.nlm.nih.gov/pubmed/33483508 http://dx.doi.org/10.1038/s41467-020-20622-1 |
_version_ | 1783639734613966848 |
---|---|
author | Monaco, Daniel R. Sie, Brandon M. Nirschl, Thomas R. Knight, Audrey C. Sampson, Hugh A. Nowak-Wegrzyn, Anna Wood, Robert A. Hamilton, Robert G. Frischmeyer-Guerrerio, Pamela A. Larman, H. Benjamin |
author_facet | Monaco, Daniel R. Sie, Brandon M. Nirschl, Thomas R. Knight, Audrey C. Sampson, Hugh A. Nowak-Wegrzyn, Anna Wood, Robert A. Hamilton, Robert G. Frischmeyer-Guerrerio, Pamela A. Larman, H. Benjamin |
author_sort | Monaco, Daniel R. |
collection | PubMed |
description | Allergic reactions occur when IgE molecules become crosslinked by antigens such as food proteins. Here we create the ‘AllerScan’ programmable phage display system to characterize the binding specificities of anti-allergen IgG and IgE antibodies in serum against thousands of allergenic proteins from hundreds of organisms at peptide resolution. Using AllerScan, we identify robust anti-wheat IgE reactivities in wheat allergic individuals but not in wheat-sensitized individuals. Meanwhile, a key wheat epitope in alpha purothionin elicits dominant IgE responses among allergic patients, and frequent IgG responses among sensitized and non-allergic patients. A double-blind, placebo-controlled trial shows that alpha purothionin reactivity, among others, is strongly modulated by oral immunotherapy in tolerized individuals. AllerScan may thus serve as a high-throughput platform for unbiased analysis of anti-allergen antibody specificities. |
format | Online Article Text |
id | pubmed-7822912 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Nature Publishing Group UK |
record_format | MEDLINE/PubMed |
spelling | pubmed-78229122021-01-29 Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes Monaco, Daniel R. Sie, Brandon M. Nirschl, Thomas R. Knight, Audrey C. Sampson, Hugh A. Nowak-Wegrzyn, Anna Wood, Robert A. Hamilton, Robert G. Frischmeyer-Guerrerio, Pamela A. Larman, H. Benjamin Nat Commun Article Allergic reactions occur when IgE molecules become crosslinked by antigens such as food proteins. Here we create the ‘AllerScan’ programmable phage display system to characterize the binding specificities of anti-allergen IgG and IgE antibodies in serum against thousands of allergenic proteins from hundreds of organisms at peptide resolution. Using AllerScan, we identify robust anti-wheat IgE reactivities in wheat allergic individuals but not in wheat-sensitized individuals. Meanwhile, a key wheat epitope in alpha purothionin elicits dominant IgE responses among allergic patients, and frequent IgG responses among sensitized and non-allergic patients. A double-blind, placebo-controlled trial shows that alpha purothionin reactivity, among others, is strongly modulated by oral immunotherapy in tolerized individuals. AllerScan may thus serve as a high-throughput platform for unbiased analysis of anti-allergen antibody specificities. Nature Publishing Group UK 2021-01-22 /pmc/articles/PMC7822912/ /pubmed/33483508 http://dx.doi.org/10.1038/s41467-020-20622-1 Text en © The Author(s) 2021 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/. |
spellingShingle | Article Monaco, Daniel R. Sie, Brandon M. Nirschl, Thomas R. Knight, Audrey C. Sampson, Hugh A. Nowak-Wegrzyn, Anna Wood, Robert A. Hamilton, Robert G. Frischmeyer-Guerrerio, Pamela A. Larman, H. Benjamin Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes |
title | Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes |
title_full | Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes |
title_fullStr | Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes |
title_full_unstemmed | Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes |
title_short | Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes |
title_sort | profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7822912/ https://www.ncbi.nlm.nih.gov/pubmed/33483508 http://dx.doi.org/10.1038/s41467-020-20622-1 |
work_keys_str_mv | AT monacodanielr profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes AT siebrandonm profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes AT nirschlthomasr profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes AT knightaudreyc profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes AT sampsonhugha profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes AT nowakwegrzynanna profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes AT woodroberta profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes AT hamiltonrobertg profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes AT frischmeyerguerreriopamelaa profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes AT larmanhbenjamin profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes |