Cargando…

Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes

Allergic reactions occur when IgE molecules become crosslinked by antigens such as food proteins. Here we create the ‘AllerScan’ programmable phage display system to characterize the binding specificities of anti-allergen IgG and IgE antibodies in serum against thousands of allergenic proteins from...

Descripción completa

Detalles Bibliográficos
Autores principales: Monaco, Daniel R., Sie, Brandon M., Nirschl, Thomas R., Knight, Audrey C., Sampson, Hugh A., Nowak-Wegrzyn, Anna, Wood, Robert A., Hamilton, Robert G., Frischmeyer-Guerrerio, Pamela A., Larman, H. Benjamin
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group UK 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7822912/
https://www.ncbi.nlm.nih.gov/pubmed/33483508
http://dx.doi.org/10.1038/s41467-020-20622-1
_version_ 1783639734613966848
author Monaco, Daniel R.
Sie, Brandon M.
Nirschl, Thomas R.
Knight, Audrey C.
Sampson, Hugh A.
Nowak-Wegrzyn, Anna
Wood, Robert A.
Hamilton, Robert G.
Frischmeyer-Guerrerio, Pamela A.
Larman, H. Benjamin
author_facet Monaco, Daniel R.
Sie, Brandon M.
Nirschl, Thomas R.
Knight, Audrey C.
Sampson, Hugh A.
Nowak-Wegrzyn, Anna
Wood, Robert A.
Hamilton, Robert G.
Frischmeyer-Guerrerio, Pamela A.
Larman, H. Benjamin
author_sort Monaco, Daniel R.
collection PubMed
description Allergic reactions occur when IgE molecules become crosslinked by antigens such as food proteins. Here we create the ‘AllerScan’ programmable phage display system to characterize the binding specificities of anti-allergen IgG and IgE antibodies in serum against thousands of allergenic proteins from hundreds of organisms at peptide resolution. Using AllerScan, we identify robust anti-wheat IgE reactivities in wheat allergic individuals but not in wheat-sensitized individuals. Meanwhile, a key wheat epitope in alpha purothionin elicits dominant IgE responses among allergic patients, and frequent IgG responses among sensitized and non-allergic patients. A double-blind, placebo-controlled trial shows that alpha purothionin reactivity, among others, is strongly modulated by oral immunotherapy in tolerized individuals. AllerScan may thus serve as a high-throughput platform for unbiased analysis of anti-allergen antibody specificities.
format Online
Article
Text
id pubmed-7822912
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Nature Publishing Group UK
record_format MEDLINE/PubMed
spelling pubmed-78229122021-01-29 Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes Monaco, Daniel R. Sie, Brandon M. Nirschl, Thomas R. Knight, Audrey C. Sampson, Hugh A. Nowak-Wegrzyn, Anna Wood, Robert A. Hamilton, Robert G. Frischmeyer-Guerrerio, Pamela A. Larman, H. Benjamin Nat Commun Article Allergic reactions occur when IgE molecules become crosslinked by antigens such as food proteins. Here we create the ‘AllerScan’ programmable phage display system to characterize the binding specificities of anti-allergen IgG and IgE antibodies in serum against thousands of allergenic proteins from hundreds of organisms at peptide resolution. Using AllerScan, we identify robust anti-wheat IgE reactivities in wheat allergic individuals but not in wheat-sensitized individuals. Meanwhile, a key wheat epitope in alpha purothionin elicits dominant IgE responses among allergic patients, and frequent IgG responses among sensitized and non-allergic patients. A double-blind, placebo-controlled trial shows that alpha purothionin reactivity, among others, is strongly modulated by oral immunotherapy in tolerized individuals. AllerScan may thus serve as a high-throughput platform for unbiased analysis of anti-allergen antibody specificities. Nature Publishing Group UK 2021-01-22 /pmc/articles/PMC7822912/ /pubmed/33483508 http://dx.doi.org/10.1038/s41467-020-20622-1 Text en © The Author(s) 2021 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/.
spellingShingle Article
Monaco, Daniel R.
Sie, Brandon M.
Nirschl, Thomas R.
Knight, Audrey C.
Sampson, Hugh A.
Nowak-Wegrzyn, Anna
Wood, Robert A.
Hamilton, Robert G.
Frischmeyer-Guerrerio, Pamela A.
Larman, H. Benjamin
Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes
title Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes
title_full Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes
title_fullStr Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes
title_full_unstemmed Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes
title_short Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes
title_sort profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7822912/
https://www.ncbi.nlm.nih.gov/pubmed/33483508
http://dx.doi.org/10.1038/s41467-020-20622-1
work_keys_str_mv AT monacodanielr profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes
AT siebrandonm profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes
AT nirschlthomasr profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes
AT knightaudreyc profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes
AT sampsonhugha profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes
AT nowakwegrzynanna profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes
AT woodroberta profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes
AT hamiltonrobertg profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes
AT frischmeyerguerreriopamelaa profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes
AT larmanhbenjamin profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes