Cargando…

FKBP5 polymorphisms induce differential glucocorticoid responsiveness in primary CNS cells – First insights from novel humanized mice

The brain is a central hub for integration of internal and external conditions and, thus, a regulator of the stress response. Glucocorticoids are the essential communicators of this response. Aberrations in glucocorticoid signaling are a common symptom in patients with psychiatric disorders. The gen...

Descripción completa

Detalles Bibliográficos
Autores principales: Nold, Verena, Richter, Nadine, Hengerer, Bastian, Kolassa, Iris‐Tatjana, Allers, Kelly Ann
Formato: Online Artículo Texto
Lenguaje:English
Publicado: John Wiley and Sons Inc. 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7894319/
https://www.ncbi.nlm.nih.gov/pubmed/33030232
http://dx.doi.org/10.1111/ejn.14999
_version_ 1783653225725952000
author Nold, Verena
Richter, Nadine
Hengerer, Bastian
Kolassa, Iris‐Tatjana
Allers, Kelly Ann
author_facet Nold, Verena
Richter, Nadine
Hengerer, Bastian
Kolassa, Iris‐Tatjana
Allers, Kelly Ann
author_sort Nold, Verena
collection PubMed
description The brain is a central hub for integration of internal and external conditions and, thus, a regulator of the stress response. Glucocorticoids are the essential communicators of this response. Aberrations in glucocorticoid signaling are a common symptom in patients with psychiatric disorders. The gene FKBP5 encodes a chaperone protein that functionally inhibits glucocorticoid signaling and, thus, contributes to the regulation of stress. In the context of childhood trauma, differential expression of FKBP5 has been found in psychiatric patients compared to controls. These variations in expression levels of FKBP5 were reported to be associated with differences in stress responsiveness in human carriers of the single nucleotide polymorphism (SNP) rs1360780. Understanding the mechanisms underlying FKBP5 polymorphism‐associated glucocorticoid responsiveness in the CNS will lead to a better understanding of stress regulation or associated pathology. To study these mechanisms, two novel humanized mouse lines were generated. The lines carried either the risk (A/T) allele or the resilient (C/G) allele of rs1360780. Primary cells from CNS (astrocytes, microglia, and neurons) were analyzed for their basal expression levels of FKBP5 and their responsiveness to glucocorticoids. Differential expression of FKBP5 was found for these cell types and negatively correlated with the cellular glucocorticoid responsiveness. Astrocytes revealed the strongest transcriptional response, followed by microglia and neurons. Furthermore, the risk allele (A/T) was associated with greater induction of FKBP5 than the resilience allele. Novel FKBP5‐humanized mice display differential glucocorticoid responsiveness due to a single intronic SNP. The vulnerability to stress signaling in the shape of glucocorticoids in the brain correlated with FKBP5 expression levels. The strong responsiveness of astrocytes to glucocorticoids implies astrocytes play a prominent role in the stress response, and in FKBP5‐related differences in glucocorticoid signaling. The novel humanized mouse lines will allow for further study of the role that FKBP5 SNPs have in risk and resilience to stress pathology.
format Online
Article
Text
id pubmed-7894319
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher John Wiley and Sons Inc.
record_format MEDLINE/PubMed
spelling pubmed-78943192021-03-02 FKBP5 polymorphisms induce differential glucocorticoid responsiveness in primary CNS cells – First insights from novel humanized mice Nold, Verena Richter, Nadine Hengerer, Bastian Kolassa, Iris‐Tatjana Allers, Kelly Ann Eur J Neurosci Molecular and Synaptic Mechanisms The brain is a central hub for integration of internal and external conditions and, thus, a regulator of the stress response. Glucocorticoids are the essential communicators of this response. Aberrations in glucocorticoid signaling are a common symptom in patients with psychiatric disorders. The gene FKBP5 encodes a chaperone protein that functionally inhibits glucocorticoid signaling and, thus, contributes to the regulation of stress. In the context of childhood trauma, differential expression of FKBP5 has been found in psychiatric patients compared to controls. These variations in expression levels of FKBP5 were reported to be associated with differences in stress responsiveness in human carriers of the single nucleotide polymorphism (SNP) rs1360780. Understanding the mechanisms underlying FKBP5 polymorphism‐associated glucocorticoid responsiveness in the CNS will lead to a better understanding of stress regulation or associated pathology. To study these mechanisms, two novel humanized mouse lines were generated. The lines carried either the risk (A/T) allele or the resilient (C/G) allele of rs1360780. Primary cells from CNS (astrocytes, microglia, and neurons) were analyzed for their basal expression levels of FKBP5 and their responsiveness to glucocorticoids. Differential expression of FKBP5 was found for these cell types and negatively correlated with the cellular glucocorticoid responsiveness. Astrocytes revealed the strongest transcriptional response, followed by microglia and neurons. Furthermore, the risk allele (A/T) was associated with greater induction of FKBP5 than the resilience allele. Novel FKBP5‐humanized mice display differential glucocorticoid responsiveness due to a single intronic SNP. The vulnerability to stress signaling in the shape of glucocorticoids in the brain correlated with FKBP5 expression levels. The strong responsiveness of astrocytes to glucocorticoids implies astrocytes play a prominent role in the stress response, and in FKBP5‐related differences in glucocorticoid signaling. The novel humanized mouse lines will allow for further study of the role that FKBP5 SNPs have in risk and resilience to stress pathology. John Wiley and Sons Inc. 2020-10-27 2021-01 /pmc/articles/PMC7894319/ /pubmed/33030232 http://dx.doi.org/10.1111/ejn.14999 Text en © 2020 Federation of European Neuroscience Societies and John Wiley & Sons Ltd This is an open access article under the terms of the http://creativecommons.org/licenses/by/4.0/ License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited.
spellingShingle Molecular and Synaptic Mechanisms
Nold, Verena
Richter, Nadine
Hengerer, Bastian
Kolassa, Iris‐Tatjana
Allers, Kelly Ann
FKBP5 polymorphisms induce differential glucocorticoid responsiveness in primary CNS cells – First insights from novel humanized mice
title FKBP5 polymorphisms induce differential glucocorticoid responsiveness in primary CNS cells – First insights from novel humanized mice
title_full FKBP5 polymorphisms induce differential glucocorticoid responsiveness in primary CNS cells – First insights from novel humanized mice
title_fullStr FKBP5 polymorphisms induce differential glucocorticoid responsiveness in primary CNS cells – First insights from novel humanized mice
title_full_unstemmed FKBP5 polymorphisms induce differential glucocorticoid responsiveness in primary CNS cells – First insights from novel humanized mice
title_short FKBP5 polymorphisms induce differential glucocorticoid responsiveness in primary CNS cells – First insights from novel humanized mice
title_sort fkbp5 polymorphisms induce differential glucocorticoid responsiveness in primary cns cells – first insights from novel humanized mice
topic Molecular and Synaptic Mechanisms
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7894319/
https://www.ncbi.nlm.nih.gov/pubmed/33030232
http://dx.doi.org/10.1111/ejn.14999
work_keys_str_mv AT noldverena fkbp5polymorphismsinducedifferentialglucocorticoidresponsivenessinprimarycnscellsfirstinsightsfromnovelhumanizedmice
AT richternadine fkbp5polymorphismsinducedifferentialglucocorticoidresponsivenessinprimarycnscellsfirstinsightsfromnovelhumanizedmice
AT hengererbastian fkbp5polymorphismsinducedifferentialglucocorticoidresponsivenessinprimarycnscellsfirstinsightsfromnovelhumanizedmice
AT kolassairistatjana fkbp5polymorphismsinducedifferentialglucocorticoidresponsivenessinprimarycnscellsfirstinsightsfromnovelhumanizedmice
AT allerskellyann fkbp5polymorphismsinducedifferentialglucocorticoidresponsivenessinprimarycnscellsfirstinsightsfromnovelhumanizedmice