Cargando…
Depletion of EREG enhances the osteo/dentinogenic differentiation ability of dental pulp stem cells via the p38 MAPK and Erk pathways in an inflammatory microenvironment
BACKGROUND: Epiregulin (EREG) is an important component of EGF and was demonstrated to promote the osteo/dentinogenic differentiation of stem cells from dental apical papilla (SCAPs). Whether EREG can stimulate the osteo/dentinogenic differentiation of dental pulp stem cells (DPSCs) in inflammatory...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8215766/ https://www.ncbi.nlm.nih.gov/pubmed/34154572 http://dx.doi.org/10.1186/s12903-021-01675-0 |
_version_ | 1783710302561370112 |
---|---|
author | Ran, Ran Yang, Haoqing Cao, Yangyang Yan, Wanhao Jin, Luyuan Zheng, Ying |
author_facet | Ran, Ran Yang, Haoqing Cao, Yangyang Yan, Wanhao Jin, Luyuan Zheng, Ying |
author_sort | Ran, Ran |
collection | PubMed |
description | BACKGROUND: Epiregulin (EREG) is an important component of EGF and was demonstrated to promote the osteo/dentinogenic differentiation of stem cells from dental apical papilla (SCAPs). Whether EREG can stimulate the osteo/dentinogenic differentiation of dental pulp stem cells (DPSCs) in inflammatory environment is not clear. The purpose of the present study is to investigate the role of EREG on the osteo/dentinogenic differentiation ability of DPSCs in inflammatory environment. METHODS: DPSCs were isolated from human third molars. Short hairpin RNAs (shRNAs) were used to knock down EREG expression in DPSCs. Recombinant human EREG (rhEREG) protein was used in the rescue experiment. TNF-α was employed to mimic the inflammatory environment in vitro. Alkaline phosphatase (ALP) staining, Alizarin red staining, quantitative calcium analysis, and real-time RT-PCR were performed to detect osteo/dentinogenic differentiation markers and related signalling pathways under normal and inflammatory conditions. RESULTS: EREG depletion promoted the ALP activity and mineralization ability of DPSCs. The expression of BSP, DMP-1, and DSPP was also enhanced. Moreover, 50 ng/mL rhEREG treatment decreased the osteo/dentinogenic differentiation potential of DPSCs, while treatment with 10 ng/mL TNF-α for 4 h increased the expression of EREG in DPSCs. Conversely, EREG knockdown rescued the impaired osteo/dentinogenic differentiation ability caused by TNF-α treatment. Further mechanistic studies showed that EREG depletion activated the p38 MAPK and Erk signalling pathways in DPSCs under normal and inflammatory conditions. CONCLUSIONS: Our results demonstrated that EREG could inhibit the osteo/dentinogenic differentiation potential of DPSCs via the p38 MAPK and Erk signalling pathways. Under inflammatory environment, EREG depletion enhanced osteo/dentinogenic differentiation potential of DPSCs by improving the expression of p-p38 MAPK and p-Erk. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12903-021-01675-0. |
format | Online Article Text |
id | pubmed-8215766 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-82157662021-06-23 Depletion of EREG enhances the osteo/dentinogenic differentiation ability of dental pulp stem cells via the p38 MAPK and Erk pathways in an inflammatory microenvironment Ran, Ran Yang, Haoqing Cao, Yangyang Yan, Wanhao Jin, Luyuan Zheng, Ying BMC Oral Health Research BACKGROUND: Epiregulin (EREG) is an important component of EGF and was demonstrated to promote the osteo/dentinogenic differentiation of stem cells from dental apical papilla (SCAPs). Whether EREG can stimulate the osteo/dentinogenic differentiation of dental pulp stem cells (DPSCs) in inflammatory environment is not clear. The purpose of the present study is to investigate the role of EREG on the osteo/dentinogenic differentiation ability of DPSCs in inflammatory environment. METHODS: DPSCs were isolated from human third molars. Short hairpin RNAs (shRNAs) were used to knock down EREG expression in DPSCs. Recombinant human EREG (rhEREG) protein was used in the rescue experiment. TNF-α was employed to mimic the inflammatory environment in vitro. Alkaline phosphatase (ALP) staining, Alizarin red staining, quantitative calcium analysis, and real-time RT-PCR were performed to detect osteo/dentinogenic differentiation markers and related signalling pathways under normal and inflammatory conditions. RESULTS: EREG depletion promoted the ALP activity and mineralization ability of DPSCs. The expression of BSP, DMP-1, and DSPP was also enhanced. Moreover, 50 ng/mL rhEREG treatment decreased the osteo/dentinogenic differentiation potential of DPSCs, while treatment with 10 ng/mL TNF-α for 4 h increased the expression of EREG in DPSCs. Conversely, EREG knockdown rescued the impaired osteo/dentinogenic differentiation ability caused by TNF-α treatment. Further mechanistic studies showed that EREG depletion activated the p38 MAPK and Erk signalling pathways in DPSCs under normal and inflammatory conditions. CONCLUSIONS: Our results demonstrated that EREG could inhibit the osteo/dentinogenic differentiation potential of DPSCs via the p38 MAPK and Erk signalling pathways. Under inflammatory environment, EREG depletion enhanced osteo/dentinogenic differentiation potential of DPSCs by improving the expression of p-p38 MAPK and p-Erk. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12903-021-01675-0. BioMed Central 2021-06-21 /pmc/articles/PMC8215766/ /pubmed/34154572 http://dx.doi.org/10.1186/s12903-021-01675-0 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Ran, Ran Yang, Haoqing Cao, Yangyang Yan, Wanhao Jin, Luyuan Zheng, Ying Depletion of EREG enhances the osteo/dentinogenic differentiation ability of dental pulp stem cells via the p38 MAPK and Erk pathways in an inflammatory microenvironment |
title | Depletion of EREG enhances the osteo/dentinogenic differentiation ability of dental pulp stem cells via the p38 MAPK and Erk pathways in an inflammatory microenvironment |
title_full | Depletion of EREG enhances the osteo/dentinogenic differentiation ability of dental pulp stem cells via the p38 MAPK and Erk pathways in an inflammatory microenvironment |
title_fullStr | Depletion of EREG enhances the osteo/dentinogenic differentiation ability of dental pulp stem cells via the p38 MAPK and Erk pathways in an inflammatory microenvironment |
title_full_unstemmed | Depletion of EREG enhances the osteo/dentinogenic differentiation ability of dental pulp stem cells via the p38 MAPK and Erk pathways in an inflammatory microenvironment |
title_short | Depletion of EREG enhances the osteo/dentinogenic differentiation ability of dental pulp stem cells via the p38 MAPK and Erk pathways in an inflammatory microenvironment |
title_sort | depletion of ereg enhances the osteo/dentinogenic differentiation ability of dental pulp stem cells via the p38 mapk and erk pathways in an inflammatory microenvironment |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8215766/ https://www.ncbi.nlm.nih.gov/pubmed/34154572 http://dx.doi.org/10.1186/s12903-021-01675-0 |
work_keys_str_mv | AT ranran depletionoferegenhancestheosteodentinogenicdifferentiationabilityofdentalpulpstemcellsviathep38mapkanderkpathwaysinaninflammatorymicroenvironment AT yanghaoqing depletionoferegenhancestheosteodentinogenicdifferentiationabilityofdentalpulpstemcellsviathep38mapkanderkpathwaysinaninflammatorymicroenvironment AT caoyangyang depletionoferegenhancestheosteodentinogenicdifferentiationabilityofdentalpulpstemcellsviathep38mapkanderkpathwaysinaninflammatorymicroenvironment AT yanwanhao depletionoferegenhancestheosteodentinogenicdifferentiationabilityofdentalpulpstemcellsviathep38mapkanderkpathwaysinaninflammatorymicroenvironment AT jinluyuan depletionoferegenhancestheosteodentinogenicdifferentiationabilityofdentalpulpstemcellsviathep38mapkanderkpathwaysinaninflammatorymicroenvironment AT zhengying depletionoferegenhancestheosteodentinogenicdifferentiationabilityofdentalpulpstemcellsviathep38mapkanderkpathwaysinaninflammatorymicroenvironment |