Cargando…

Myelin Defects in Niemann–Pick Type C Disease: Mechanisms and Possible Therapeutic Perspectives

Niemann–Pick type C (NPC) disease is a wide-spectrum clinical condition classified as a neurovisceral disorder affecting mainly the liver and the brain. It is caused by mutations in one of two genes, NPC1 and NPC2, coding for proteins located in the lysosomes. NPC proteins are deputed to transport c...

Descripción completa

Detalles Bibliográficos
Autores principales: Bernardo, Antonietta, De Nuccio, Chiara, Visentin, Sergio, Martire, Alberto, Minghetti, Luisa, Popoli, Patrizia, Ferrante, Antonella
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8396228/
https://www.ncbi.nlm.nih.gov/pubmed/34445564
http://dx.doi.org/10.3390/ijms22168858
_version_ 1783744324477911040
author Bernardo, Antonietta
De Nuccio, Chiara
Visentin, Sergio
Martire, Alberto
Minghetti, Luisa
Popoli, Patrizia
Ferrante, Antonella
author_facet Bernardo, Antonietta
De Nuccio, Chiara
Visentin, Sergio
Martire, Alberto
Minghetti, Luisa
Popoli, Patrizia
Ferrante, Antonella
author_sort Bernardo, Antonietta
collection PubMed
description Niemann–Pick type C (NPC) disease is a wide-spectrum clinical condition classified as a neurovisceral disorder affecting mainly the liver and the brain. It is caused by mutations in one of two genes, NPC1 and NPC2, coding for proteins located in the lysosomes. NPC proteins are deputed to transport cholesterol within lysosomes or between late endosome/lysosome systems and other cellular compartments, such as the endoplasmic reticulum and plasma membrane. The first trait of NPC is the accumulation of unesterified cholesterol and other lipids, like sphingosine and glycosphingolipids, in the late endosomal and lysosomal compartments, which causes the blockade of autophagic flux and the impairment of mitochondrial functions. In the brain, the main consequences of NPC are cerebellar neurodegeneration, neuroinflammation, and myelin defects. This review will focus on myelin defects and the pivotal importance of cholesterol for myelination and will offer an overview of the molecular targets and the pharmacological strategies so far proposed, or an object of clinical trials for NPC. Finally, it will summarize recent data on a new and promising pharmacological perspective involving A(2A) adenosine receptor stimulation in genetic and pharmacological NPC dysmyelination models.
format Online
Article
Text
id pubmed-8396228
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-83962282021-08-28 Myelin Defects in Niemann–Pick Type C Disease: Mechanisms and Possible Therapeutic Perspectives Bernardo, Antonietta De Nuccio, Chiara Visentin, Sergio Martire, Alberto Minghetti, Luisa Popoli, Patrizia Ferrante, Antonella Int J Mol Sci Review Niemann–Pick type C (NPC) disease is a wide-spectrum clinical condition classified as a neurovisceral disorder affecting mainly the liver and the brain. It is caused by mutations in one of two genes, NPC1 and NPC2, coding for proteins located in the lysosomes. NPC proteins are deputed to transport cholesterol within lysosomes or between late endosome/lysosome systems and other cellular compartments, such as the endoplasmic reticulum and plasma membrane. The first trait of NPC is the accumulation of unesterified cholesterol and other lipids, like sphingosine and glycosphingolipids, in the late endosomal and lysosomal compartments, which causes the blockade of autophagic flux and the impairment of mitochondrial functions. In the brain, the main consequences of NPC are cerebellar neurodegeneration, neuroinflammation, and myelin defects. This review will focus on myelin defects and the pivotal importance of cholesterol for myelination and will offer an overview of the molecular targets and the pharmacological strategies so far proposed, or an object of clinical trials for NPC. Finally, it will summarize recent data on a new and promising pharmacological perspective involving A(2A) adenosine receptor stimulation in genetic and pharmacological NPC dysmyelination models. MDPI 2021-08-17 /pmc/articles/PMC8396228/ /pubmed/34445564 http://dx.doi.org/10.3390/ijms22168858 Text en © 2021 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Review
Bernardo, Antonietta
De Nuccio, Chiara
Visentin, Sergio
Martire, Alberto
Minghetti, Luisa
Popoli, Patrizia
Ferrante, Antonella
Myelin Defects in Niemann–Pick Type C Disease: Mechanisms and Possible Therapeutic Perspectives
title Myelin Defects in Niemann–Pick Type C Disease: Mechanisms and Possible Therapeutic Perspectives
title_full Myelin Defects in Niemann–Pick Type C Disease: Mechanisms and Possible Therapeutic Perspectives
title_fullStr Myelin Defects in Niemann–Pick Type C Disease: Mechanisms and Possible Therapeutic Perspectives
title_full_unstemmed Myelin Defects in Niemann–Pick Type C Disease: Mechanisms and Possible Therapeutic Perspectives
title_short Myelin Defects in Niemann–Pick Type C Disease: Mechanisms and Possible Therapeutic Perspectives
title_sort myelin defects in niemann–pick type c disease: mechanisms and possible therapeutic perspectives
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8396228/
https://www.ncbi.nlm.nih.gov/pubmed/34445564
http://dx.doi.org/10.3390/ijms22168858
work_keys_str_mv AT bernardoantonietta myelindefectsinniemannpicktypecdiseasemechanismsandpossibletherapeuticperspectives
AT denucciochiara myelindefectsinniemannpicktypecdiseasemechanismsandpossibletherapeuticperspectives
AT visentinsergio myelindefectsinniemannpicktypecdiseasemechanismsandpossibletherapeuticperspectives
AT martirealberto myelindefectsinniemannpicktypecdiseasemechanismsandpossibletherapeuticperspectives
AT minghettiluisa myelindefectsinniemannpicktypecdiseasemechanismsandpossibletherapeuticperspectives
AT popolipatrizia myelindefectsinniemannpicktypecdiseasemechanismsandpossibletherapeuticperspectives
AT ferranteantonella myelindefectsinniemannpicktypecdiseasemechanismsandpossibletherapeuticperspectives