Cargando…
Myelin Defects in Niemann–Pick Type C Disease: Mechanisms and Possible Therapeutic Perspectives
Niemann–Pick type C (NPC) disease is a wide-spectrum clinical condition classified as a neurovisceral disorder affecting mainly the liver and the brain. It is caused by mutations in one of two genes, NPC1 and NPC2, coding for proteins located in the lysosomes. NPC proteins are deputed to transport c...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8396228/ https://www.ncbi.nlm.nih.gov/pubmed/34445564 http://dx.doi.org/10.3390/ijms22168858 |
_version_ | 1783744324477911040 |
---|---|
author | Bernardo, Antonietta De Nuccio, Chiara Visentin, Sergio Martire, Alberto Minghetti, Luisa Popoli, Patrizia Ferrante, Antonella |
author_facet | Bernardo, Antonietta De Nuccio, Chiara Visentin, Sergio Martire, Alberto Minghetti, Luisa Popoli, Patrizia Ferrante, Antonella |
author_sort | Bernardo, Antonietta |
collection | PubMed |
description | Niemann–Pick type C (NPC) disease is a wide-spectrum clinical condition classified as a neurovisceral disorder affecting mainly the liver and the brain. It is caused by mutations in one of two genes, NPC1 and NPC2, coding for proteins located in the lysosomes. NPC proteins are deputed to transport cholesterol within lysosomes or between late endosome/lysosome systems and other cellular compartments, such as the endoplasmic reticulum and plasma membrane. The first trait of NPC is the accumulation of unesterified cholesterol and other lipids, like sphingosine and glycosphingolipids, in the late endosomal and lysosomal compartments, which causes the blockade of autophagic flux and the impairment of mitochondrial functions. In the brain, the main consequences of NPC are cerebellar neurodegeneration, neuroinflammation, and myelin defects. This review will focus on myelin defects and the pivotal importance of cholesterol for myelination and will offer an overview of the molecular targets and the pharmacological strategies so far proposed, or an object of clinical trials for NPC. Finally, it will summarize recent data on a new and promising pharmacological perspective involving A(2A) adenosine receptor stimulation in genetic and pharmacological NPC dysmyelination models. |
format | Online Article Text |
id | pubmed-8396228 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-83962282021-08-28 Myelin Defects in Niemann–Pick Type C Disease: Mechanisms and Possible Therapeutic Perspectives Bernardo, Antonietta De Nuccio, Chiara Visentin, Sergio Martire, Alberto Minghetti, Luisa Popoli, Patrizia Ferrante, Antonella Int J Mol Sci Review Niemann–Pick type C (NPC) disease is a wide-spectrum clinical condition classified as a neurovisceral disorder affecting mainly the liver and the brain. It is caused by mutations in one of two genes, NPC1 and NPC2, coding for proteins located in the lysosomes. NPC proteins are deputed to transport cholesterol within lysosomes or between late endosome/lysosome systems and other cellular compartments, such as the endoplasmic reticulum and plasma membrane. The first trait of NPC is the accumulation of unesterified cholesterol and other lipids, like sphingosine and glycosphingolipids, in the late endosomal and lysosomal compartments, which causes the blockade of autophagic flux and the impairment of mitochondrial functions. In the brain, the main consequences of NPC are cerebellar neurodegeneration, neuroinflammation, and myelin defects. This review will focus on myelin defects and the pivotal importance of cholesterol for myelination and will offer an overview of the molecular targets and the pharmacological strategies so far proposed, or an object of clinical trials for NPC. Finally, it will summarize recent data on a new and promising pharmacological perspective involving A(2A) adenosine receptor stimulation in genetic and pharmacological NPC dysmyelination models. MDPI 2021-08-17 /pmc/articles/PMC8396228/ /pubmed/34445564 http://dx.doi.org/10.3390/ijms22168858 Text en © 2021 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Review Bernardo, Antonietta De Nuccio, Chiara Visentin, Sergio Martire, Alberto Minghetti, Luisa Popoli, Patrizia Ferrante, Antonella Myelin Defects in Niemann–Pick Type C Disease: Mechanisms and Possible Therapeutic Perspectives |
title | Myelin Defects in Niemann–Pick Type C Disease: Mechanisms and Possible Therapeutic Perspectives |
title_full | Myelin Defects in Niemann–Pick Type C Disease: Mechanisms and Possible Therapeutic Perspectives |
title_fullStr | Myelin Defects in Niemann–Pick Type C Disease: Mechanisms and Possible Therapeutic Perspectives |
title_full_unstemmed | Myelin Defects in Niemann–Pick Type C Disease: Mechanisms and Possible Therapeutic Perspectives |
title_short | Myelin Defects in Niemann–Pick Type C Disease: Mechanisms and Possible Therapeutic Perspectives |
title_sort | myelin defects in niemann–pick type c disease: mechanisms and possible therapeutic perspectives |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8396228/ https://www.ncbi.nlm.nih.gov/pubmed/34445564 http://dx.doi.org/10.3390/ijms22168858 |
work_keys_str_mv | AT bernardoantonietta myelindefectsinniemannpicktypecdiseasemechanismsandpossibletherapeuticperspectives AT denucciochiara myelindefectsinniemannpicktypecdiseasemechanismsandpossibletherapeuticperspectives AT visentinsergio myelindefectsinniemannpicktypecdiseasemechanismsandpossibletherapeuticperspectives AT martirealberto myelindefectsinniemannpicktypecdiseasemechanismsandpossibletherapeuticperspectives AT minghettiluisa myelindefectsinniemannpicktypecdiseasemechanismsandpossibletherapeuticperspectives AT popolipatrizia myelindefectsinniemannpicktypecdiseasemechanismsandpossibletherapeuticperspectives AT ferranteantonella myelindefectsinniemannpicktypecdiseasemechanismsandpossibletherapeuticperspectives |