Cargando…
Integrative Network Analysis Revealed Genetic Impact of Pyruvate Kinase L/R on Hepatocyte Proliferation and Graft Survival after Liver Transplantation
BACKGROUND: Pyruvate kinase L/R (PKLR) has been suggested to affect the proliferation of hepatocytes via regulation of the cell cycle and lipid metabolism. However, its impact on the global metabolome and its clinical implications remain unclear. AIMS: We aimed to clarify the genetic impact of PKLR...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8429008/ https://www.ncbi.nlm.nih.gov/pubmed/34512869 http://dx.doi.org/10.1155/2021/7182914 |
_version_ | 1783750482926239744 |
---|---|
author | Liu, Zhengtao Zhao, Junsheng Wang, Wenchao Zhu, Hai Qian, Junjie Wang, Shuai Que, Shuping Zhang, Feng Yin, Shengyong Zhou, Lin Geng, Lei Zheng, Shusen |
author_facet | Liu, Zhengtao Zhao, Junsheng Wang, Wenchao Zhu, Hai Qian, Junjie Wang, Shuai Que, Shuping Zhang, Feng Yin, Shengyong Zhou, Lin Geng, Lei Zheng, Shusen |
author_sort | Liu, Zhengtao |
collection | PubMed |
description | BACKGROUND: Pyruvate kinase L/R (PKLR) has been suggested to affect the proliferation of hepatocytes via regulation of the cell cycle and lipid metabolism. However, its impact on the global metabolome and its clinical implications remain unclear. AIMS: We aimed to clarify the genetic impact of PKLR on the metabolomic profiles of hepatoma cells and its potential effects on grafts for liver transplantation (LT). METHODS: Nontargeted and targeted metabolomic assays were performed in human hepatoma cells transfected with lentiviral vectors causing PKLR overexpression and silencing, respectively. We then constructed a molecular network based on integrative analysis of transcriptomic and metabolomic data. We also assessed the biological functions of PKLR in the global metabolome in LT grafts in patients via a weighted correlation network model. RESULTS: Multiomic analysis revealed that PKLR perturbations significantly affected the pyruvate, citrate, and glycerophospholipid metabolism pathways, as crucial steps in de novo lipogenesis (DNL). We also confirmed the importance of phosphatidylcholines (PC) and its derivative lyso-PC supply on improved survival of LT grafts in patients. Coexpression analysis revealed beneficial effects of PKLR overexpression on posttransplant prognosis by alleviating arachidonic acid metabolism of the grafts, independent of operational risk factors. CONCLUSION: This systems-level analysis indicated that PKLR affected hepatoma cell viability via impacts on the whole process of DNL, from glycolysis to final PC synthesis. PKLR also improved prognosis after LT, possibly via its impact on the increased genesis of beneficial glycerophospholipids. |
format | Online Article Text |
id | pubmed-8429008 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Hindawi |
record_format | MEDLINE/PubMed |
spelling | pubmed-84290082021-09-10 Integrative Network Analysis Revealed Genetic Impact of Pyruvate Kinase L/R on Hepatocyte Proliferation and Graft Survival after Liver Transplantation Liu, Zhengtao Zhao, Junsheng Wang, Wenchao Zhu, Hai Qian, Junjie Wang, Shuai Que, Shuping Zhang, Feng Yin, Shengyong Zhou, Lin Geng, Lei Zheng, Shusen Oxid Med Cell Longev Research Article BACKGROUND: Pyruvate kinase L/R (PKLR) has been suggested to affect the proliferation of hepatocytes via regulation of the cell cycle and lipid metabolism. However, its impact on the global metabolome and its clinical implications remain unclear. AIMS: We aimed to clarify the genetic impact of PKLR on the metabolomic profiles of hepatoma cells and its potential effects on grafts for liver transplantation (LT). METHODS: Nontargeted and targeted metabolomic assays were performed in human hepatoma cells transfected with lentiviral vectors causing PKLR overexpression and silencing, respectively. We then constructed a molecular network based on integrative analysis of transcriptomic and metabolomic data. We also assessed the biological functions of PKLR in the global metabolome in LT grafts in patients via a weighted correlation network model. RESULTS: Multiomic analysis revealed that PKLR perturbations significantly affected the pyruvate, citrate, and glycerophospholipid metabolism pathways, as crucial steps in de novo lipogenesis (DNL). We also confirmed the importance of phosphatidylcholines (PC) and its derivative lyso-PC supply on improved survival of LT grafts in patients. Coexpression analysis revealed beneficial effects of PKLR overexpression on posttransplant prognosis by alleviating arachidonic acid metabolism of the grafts, independent of operational risk factors. CONCLUSION: This systems-level analysis indicated that PKLR affected hepatoma cell viability via impacts on the whole process of DNL, from glycolysis to final PC synthesis. PKLR also improved prognosis after LT, possibly via its impact on the increased genesis of beneficial glycerophospholipids. Hindawi 2021-09-02 /pmc/articles/PMC8429008/ /pubmed/34512869 http://dx.doi.org/10.1155/2021/7182914 Text en Copyright © 2021 Zhengtao Liu et al. https://creativecommons.org/licenses/by/4.0/This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Liu, Zhengtao Zhao, Junsheng Wang, Wenchao Zhu, Hai Qian, Junjie Wang, Shuai Que, Shuping Zhang, Feng Yin, Shengyong Zhou, Lin Geng, Lei Zheng, Shusen Integrative Network Analysis Revealed Genetic Impact of Pyruvate Kinase L/R on Hepatocyte Proliferation and Graft Survival after Liver Transplantation |
title | Integrative Network Analysis Revealed Genetic Impact of Pyruvate Kinase L/R on Hepatocyte Proliferation and Graft Survival after Liver Transplantation |
title_full | Integrative Network Analysis Revealed Genetic Impact of Pyruvate Kinase L/R on Hepatocyte Proliferation and Graft Survival after Liver Transplantation |
title_fullStr | Integrative Network Analysis Revealed Genetic Impact of Pyruvate Kinase L/R on Hepatocyte Proliferation and Graft Survival after Liver Transplantation |
title_full_unstemmed | Integrative Network Analysis Revealed Genetic Impact of Pyruvate Kinase L/R on Hepatocyte Proliferation and Graft Survival after Liver Transplantation |
title_short | Integrative Network Analysis Revealed Genetic Impact of Pyruvate Kinase L/R on Hepatocyte Proliferation and Graft Survival after Liver Transplantation |
title_sort | integrative network analysis revealed genetic impact of pyruvate kinase l/r on hepatocyte proliferation and graft survival after liver transplantation |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8429008/ https://www.ncbi.nlm.nih.gov/pubmed/34512869 http://dx.doi.org/10.1155/2021/7182914 |
work_keys_str_mv | AT liuzhengtao integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation AT zhaojunsheng integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation AT wangwenchao integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation AT zhuhai integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation AT qianjunjie integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation AT wangshuai integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation AT queshuping integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation AT zhangfeng integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation AT yinshengyong integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation AT zhoulin integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation AT genglei integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation AT zhengshusen integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation |