Cargando…

Integrative Network Analysis Revealed Genetic Impact of Pyruvate Kinase L/R on Hepatocyte Proliferation and Graft Survival after Liver Transplantation

BACKGROUND: Pyruvate kinase L/R (PKLR) has been suggested to affect the proliferation of hepatocytes via regulation of the cell cycle and lipid metabolism. However, its impact on the global metabolome and its clinical implications remain unclear. AIMS: We aimed to clarify the genetic impact of PKLR...

Descripción completa

Detalles Bibliográficos
Autores principales: Liu, Zhengtao, Zhao, Junsheng, Wang, Wenchao, Zhu, Hai, Qian, Junjie, Wang, Shuai, Que, Shuping, Zhang, Feng, Yin, Shengyong, Zhou, Lin, Geng, Lei, Zheng, Shusen
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Hindawi 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8429008/
https://www.ncbi.nlm.nih.gov/pubmed/34512869
http://dx.doi.org/10.1155/2021/7182914
_version_ 1783750482926239744
author Liu, Zhengtao
Zhao, Junsheng
Wang, Wenchao
Zhu, Hai
Qian, Junjie
Wang, Shuai
Que, Shuping
Zhang, Feng
Yin, Shengyong
Zhou, Lin
Geng, Lei
Zheng, Shusen
author_facet Liu, Zhengtao
Zhao, Junsheng
Wang, Wenchao
Zhu, Hai
Qian, Junjie
Wang, Shuai
Que, Shuping
Zhang, Feng
Yin, Shengyong
Zhou, Lin
Geng, Lei
Zheng, Shusen
author_sort Liu, Zhengtao
collection PubMed
description BACKGROUND: Pyruvate kinase L/R (PKLR) has been suggested to affect the proliferation of hepatocytes via regulation of the cell cycle and lipid metabolism. However, its impact on the global metabolome and its clinical implications remain unclear. AIMS: We aimed to clarify the genetic impact of PKLR on the metabolomic profiles of hepatoma cells and its potential effects on grafts for liver transplantation (LT). METHODS: Nontargeted and targeted metabolomic assays were performed in human hepatoma cells transfected with lentiviral vectors causing PKLR overexpression and silencing, respectively. We then constructed a molecular network based on integrative analysis of transcriptomic and metabolomic data. We also assessed the biological functions of PKLR in the global metabolome in LT grafts in patients via a weighted correlation network model. RESULTS: Multiomic analysis revealed that PKLR perturbations significantly affected the pyruvate, citrate, and glycerophospholipid metabolism pathways, as crucial steps in de novo lipogenesis (DNL). We also confirmed the importance of phosphatidylcholines (PC) and its derivative lyso-PC supply on improved survival of LT grafts in patients. Coexpression analysis revealed beneficial effects of PKLR overexpression on posttransplant prognosis by alleviating arachidonic acid metabolism of the grafts, independent of operational risk factors. CONCLUSION: This systems-level analysis indicated that PKLR affected hepatoma cell viability via impacts on the whole process of DNL, from glycolysis to final PC synthesis. PKLR also improved prognosis after LT, possibly via its impact on the increased genesis of beneficial glycerophospholipids.
format Online
Article
Text
id pubmed-8429008
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Hindawi
record_format MEDLINE/PubMed
spelling pubmed-84290082021-09-10 Integrative Network Analysis Revealed Genetic Impact of Pyruvate Kinase L/R on Hepatocyte Proliferation and Graft Survival after Liver Transplantation Liu, Zhengtao Zhao, Junsheng Wang, Wenchao Zhu, Hai Qian, Junjie Wang, Shuai Que, Shuping Zhang, Feng Yin, Shengyong Zhou, Lin Geng, Lei Zheng, Shusen Oxid Med Cell Longev Research Article BACKGROUND: Pyruvate kinase L/R (PKLR) has been suggested to affect the proliferation of hepatocytes via regulation of the cell cycle and lipid metabolism. However, its impact on the global metabolome and its clinical implications remain unclear. AIMS: We aimed to clarify the genetic impact of PKLR on the metabolomic profiles of hepatoma cells and its potential effects on grafts for liver transplantation (LT). METHODS: Nontargeted and targeted metabolomic assays were performed in human hepatoma cells transfected with lentiviral vectors causing PKLR overexpression and silencing, respectively. We then constructed a molecular network based on integrative analysis of transcriptomic and metabolomic data. We also assessed the biological functions of PKLR in the global metabolome in LT grafts in patients via a weighted correlation network model. RESULTS: Multiomic analysis revealed that PKLR perturbations significantly affected the pyruvate, citrate, and glycerophospholipid metabolism pathways, as crucial steps in de novo lipogenesis (DNL). We also confirmed the importance of phosphatidylcholines (PC) and its derivative lyso-PC supply on improved survival of LT grafts in patients. Coexpression analysis revealed beneficial effects of PKLR overexpression on posttransplant prognosis by alleviating arachidonic acid metabolism of the grafts, independent of operational risk factors. CONCLUSION: This systems-level analysis indicated that PKLR affected hepatoma cell viability via impacts on the whole process of DNL, from glycolysis to final PC synthesis. PKLR also improved prognosis after LT, possibly via its impact on the increased genesis of beneficial glycerophospholipids. Hindawi 2021-09-02 /pmc/articles/PMC8429008/ /pubmed/34512869 http://dx.doi.org/10.1155/2021/7182914 Text en Copyright © 2021 Zhengtao Liu et al. https://creativecommons.org/licenses/by/4.0/This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Article
Liu, Zhengtao
Zhao, Junsheng
Wang, Wenchao
Zhu, Hai
Qian, Junjie
Wang, Shuai
Que, Shuping
Zhang, Feng
Yin, Shengyong
Zhou, Lin
Geng, Lei
Zheng, Shusen
Integrative Network Analysis Revealed Genetic Impact of Pyruvate Kinase L/R on Hepatocyte Proliferation and Graft Survival after Liver Transplantation
title Integrative Network Analysis Revealed Genetic Impact of Pyruvate Kinase L/R on Hepatocyte Proliferation and Graft Survival after Liver Transplantation
title_full Integrative Network Analysis Revealed Genetic Impact of Pyruvate Kinase L/R on Hepatocyte Proliferation and Graft Survival after Liver Transplantation
title_fullStr Integrative Network Analysis Revealed Genetic Impact of Pyruvate Kinase L/R on Hepatocyte Proliferation and Graft Survival after Liver Transplantation
title_full_unstemmed Integrative Network Analysis Revealed Genetic Impact of Pyruvate Kinase L/R on Hepatocyte Proliferation and Graft Survival after Liver Transplantation
title_short Integrative Network Analysis Revealed Genetic Impact of Pyruvate Kinase L/R on Hepatocyte Proliferation and Graft Survival after Liver Transplantation
title_sort integrative network analysis revealed genetic impact of pyruvate kinase l/r on hepatocyte proliferation and graft survival after liver transplantation
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8429008/
https://www.ncbi.nlm.nih.gov/pubmed/34512869
http://dx.doi.org/10.1155/2021/7182914
work_keys_str_mv AT liuzhengtao integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation
AT zhaojunsheng integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation
AT wangwenchao integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation
AT zhuhai integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation
AT qianjunjie integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation
AT wangshuai integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation
AT queshuping integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation
AT zhangfeng integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation
AT yinshengyong integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation
AT zhoulin integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation
AT genglei integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation
AT zhengshusen integrativenetworkanalysisrevealedgeneticimpactofpyruvatekinaselronhepatocyteproliferationandgraftsurvivalafterlivertransplantation